(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE12

CP000124.PE12        Location/Qualifiers
FT   CDS_pept        complement(16837..17034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0017"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB8"
FT                   /protein_id="ABA48787.1"
FT                   /translation="MKTRNIQNFLMVSAAFFAMSGPARSEGAGVLATASTQMLQLAAAA
FT                   GADAPTFAGVATNGRGAMQK"
     atgaagactc gaaatatcca gaatttcctg atggtgtcgg ccgcgttttt cgcaatgagc        60
     ggcccggcgc gctcggaagg cgcgggcgtg ctggcgacgg cgagcaccca gatgctgcag       120
     cttgcggcgg cggccggcgc ggatgcgccg acgttcgcgg gcgtcgcgac gaacgggcgc       180
     ggcgcgatgc agaagtaa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page