(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE123

CP000124.PE123       Location/Qualifiers
FT   CDS_pept        138027..139145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50162"
FT                   /db_xref="GOA:Q3JY07"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY07"
FT                   /protein_id="ABA50162.1"
FT                   /translation="MVRQTFPGRAQALRQRLSALAPALVAAAALAAAGPARAAMNFCAA
FT                   PALQSSEATHAEPGVQALIKSVDAHLNDEPKALPRVHTEGTLPHEGIYDQSAEALNDME
FT                   LMRNAALAWRVTNQSRYLALVDRFLSTWVNTYRPSFNPIDETRFESLILAYDMTASALP
FT                   VKTRNAAAAFIAALGNGYVQQIDAQKRPLKGTWRNNWQSHRIKLIALAAFTLGDRRMMN
FT                   AAQRLFVEHLADNIEPDGTTYDFLERDALHYAVYDLQPLATAALAARRFNRNWLRERAP
FT                   NGATLAAALDWLAPYARGEKTHEEFVHSPVPFDAKRREAGLPGYSGMWEPKNATELFHL
FT                   AARLDGRYAGIAQQLSPMPPAWLAACLPLPAR"
     atggtgcgtc agacgtttcc gggccgcgcg caggcgctgc ggcagcgctt gagcgcgctc        60
     gcgccggcgc tcgtcgccgc cgccgcgctg gcggcggccg gccccgcgcg cgcggcgatg       120
     aatttttgcg ccgcgccggc gctgcaaagc agcgaggcga cgcatgccga accgggcgtg       180
     caggcgctca tcaagagcgt cgatgcgcat ctgaacgatg agccgaaggc gctgccgcgc       240
     gtgcacaccg agggcacgct gccgcacgag ggcatttacg accagagcgc cgaggcgctc       300
     aacgacatgg agctgatgcg caacgcggcg ctcgcgtggc gcgtgacgaa ccagagccgc       360
     tatctggcgc tcgtcgaccg ctttctgtcg acgtgggtga acacttaccg cccgagcttc       420
     aatccgatcg acgaaacgcg cttcgagagc ctgatcctcg cgtacgacat gacggcgagc       480
     gcgctgcccg tgaagacgcg caacgcggcg gccgcgttca tcgcggcgct cggcaacggc       540
     tacgtgcaac agatcgatgc gcagaagcgc ccgctcaagg gcacgtggcg caacaactgg       600
     cagagccacc ggatcaagct gatcgcgctc gccgcgttca cgctcggcga ccgtaggatg       660
     atgaacgccg cgcagcggct tttcgtcgag catctcgccg acaacatcga gcccgacggc       720
     acgacgtacg attttctcga gcgcgacgcg ctgcactacg cggtctacga tctgcagccg       780
     ctcgcgacgg ccgcgctcgc cgcgcggcgc ttcaaccgca actggctgcg cgagcgcgcg       840
     ccgaacggcg cgacgctcgc cgccgcgctc gactggctcg cgccgtacgc gcgcggcgag       900
     aagacgcacg aggagttcgt ccactcgccc gtgccgttcg acgcgaagcg ccgcgaggcg       960
     ggcctgcccg gctattccgg catgtgggag ccgaagaacg cgaccgagct gttccatctc      1020
     gccgcgcgcc tggacggccg ctacgcgggc atcgcccaac aactgtcgcc gatgccgccg      1080
     gcgtggctgg ccgcgtgcct gccgctgccg gcgcggtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page