(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE127

CP000124.PE127       Location/Qualifiers
FT   CDS_pept        143743..144810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48530"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY03"
FT                   /protein_id="ABA48530.1"
FT                   /translation="MTPTLDETALPPADALAYPGTLLSPDGRLVAPYDLERPGADARGH
FT                   VGAAARAGLLHAASGPFTLDYATLSTVHVINGMGVALGDSVIGLTALAAIKARHPHVHF
FT                   VLYRPAHAPAYVDALYRLAADAIAPIRALPWPAAELPARDTRIDLGNHLYWPAFAARPM
FT                   IDFFLASLGVPPESIPADAKCNRWLARLTLPPLPPEWRDRPYALFCPQASTPLRSIPAA
FT                   QRAALVERLARTYRLPVLGFGPIDHPDYVDVSGHSADTAQFVSWVGRARVALCSDTSAV
FT                   HIAAGFDVPTLACFSSIAPELRVRDYPLCTAIELDMPEMLRNRHKSDAANDIAQVDAAY
FT                   RRIDWDAIAWPPARE"
     atgacgccga ccctcgacga aaccgcgctg ccgcccgccg acgcgctcgc ctaccccggc        60
     acgctgcttt cgccggacgg gcggctcgtc gccccctacg atctcgaacg cccgggcgcc       120
     gacgcgcgcg gccacgtcgg cgcggcggcc cgcgccgggc tgttgcacgc ggcaagcggc       180
     ccgttcacgc tggattacgc gacgttgtcg acggttcacg tgatcaacgg gatgggcgtc       240
     gcgctcggcg attcggtgat cgggctgacc gcgctcgcgg cgatcaaggc gcggcatccg       300
     catgtgcatt tcgtgttgta ccgccccgcg cacgcgcccg cgtacgtcga cgcgctgtac       360
     cggctcgcgg ccgacgcaat cgcgccgatc cgcgcgctgc cgtggcccgc ggcggagctg       420
     ccggcgcgcg acacgcgcat cgacctcggc aatcacctgt actggcccgc attcgcggcg       480
     cggccgatga tcgacttctt tctggcgtcg ctcggcgtgc cgcccgaatc gatcccggcc       540
     gacgcgaaat gcaaccgctg gctcgcgcgg ttgacgctgc ccccgctgcc gcccgagtgg       600
     cgcgaccggc cgtacgcgct gttctgcccg caggcgagca cgccgctgcg cagcatcccg       660
     gccgcgcaac gcgcggcgct cgtcgagcgg ctcgcgcgca cctatcggct gcctgtgctc       720
     ggcttcgggc cgatcgatca tccggactat gtcgacgtga gcggccactc cgccgatacc       780
     gcgcagttcg tcagctgggt cgggcgggcg cgcgtcgcgc tctgctcgga cacgtcggcc       840
     gtgcacatcg cggccggctt cgacgtgccg acgctcgcgt gcttttcgag catcgcgccc       900
     gagctgcggg tgcgcgatta cccgctttgc acggcgatcg aactcgatat gccggagatg       960
     ctgcgcaatc gccacaaaag cgatgcggcg aacgacatcg cacaggtcga cgccgcgtac      1020
     cggcgcatcg attgggacgc gatcgcctgg ccaccggcgc gggaatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page