(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE140

CP000124.PE140       Location/Qualifiers
FT   CDS_pept        156167..156316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50685"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ0"
FT                   /protein_id="ABA50685.1"
FT                   /translation="MPGHAPRRRNAHGRAQLKALRRRQRHRFGDASAVLLARVSRHRHC
FT                   FAFA"
     ttgccgggcc atgcgccgcg ccgacgcaac gcgcacggcc gcgcgcaact caaggcactg        60
     cggcggcgac agcggcacag gttcggcgat gcgtcggcgg tgctgcttgc gcgcgtctcg       120
     cggcatcggc attgcttcgc gttcgcatga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page