(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE146

CP000124.PE146       Location/Qualifiers
FT   CDS_pept        complement(160780..161313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0153"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48439"
FT                   /db_xref="GOA:Q3JXY4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY4"
FT                   /protein_id="ABA48439.1"
FT                   /translation="MRGERLTGAGVRCARTVPRRVLRRRRRDRCGAGRVAAAGARHVGA
FT                   ARRARDRCAAAPAEFRHEPAHGWTGHVRRVLRRRASRTRAACRVSVRRHAGDGDVHVGV
FT                   SLADLPAYGADSVERVVYGIVREMGGPIAAEHGIGALKRPFPGYARSTAEIAVMRAMKA
FT                   AFDPLGMLNPGKAL"
     atgcgtggcg aacggctcac aggcgcaggc gtgcgatgcg ctcgaacagt gcctcggcgc        60
     gtgcttcgac gccggcgccg tgaccgctgc ggcgctggcc gcgtcgcagc ggcaggcgcg       120
     cgacatgtgg gcgctgcgcg aagggctcgc gatcgatgcg ctgccgcacc tgctgaattt       180
     cgacatgagc ctgcccatgg ctggactgga cacgttcgcc gcgtgctgcg acgccgcgct       240
     tcgcgcacac gggccgcatg ccgcgtgtct gtgcgtcggc atgccggcga cggcgacgtg       300
     cacgtcggcg tgtcgctcgc cgatttgccc gcgtacggcg cggacagcgt cgagcgcgtt       360
     gtctacggga tcgtgcgcga gatgggcgga ccgatagcgg ccgagcacgg catcggtgcg       420
     ctcaagcggc cgtttcccgg ttacgcgcgc agcaccgccg agatcgccgt gatgcgggcg       480
     atgaaggcgg cgttcgatcc gctcgggatg ctgaatccgg ggaaggcgtt gtag             534
//

If you have problems or comments...

PBIL Back to PBIL home page