(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE150

CP000124.PE150       Location/Qualifiers
FT   CDS_pept        complement(162577..163731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0157"
FT                   /product="aromatic aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50554"
FT                   /db_xref="GOA:Q3JXY0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY0"
FT                   /protein_id="ABA50554.1"
FT                   /translation="MQSAAAPRSKLPDVGTTIFTVIGQLAAEHEALNLSQGAPNFAPDP
FT                   ALVERVARAMRDGHNQYAPMAGIAALREALAVKTERLYGERYDPDSEVTIVASASEGLY
FT                   AAISALVHPGDEVIYFEPSFDSYAPIVRLQGATPVAIRLSPERFRVNWDEVAAKITPRT
FT                   RMLIVNTPHNPSATILGEADVARLAQLVAGTDIVVLSDEVYEHVVFDGARHHSMARDRA
FT                   LAERSVIVSSFGKSYHVTGWRVGYCLAPAELTRELRKVHQFMTFAADTPMQHAFAAALA
FT                   EPASYLELGAFYERKRDLLVRELAGSRFELLPSEGSFFMLARFGHFSDESDADFVLRAI
FT                   RDARVATIPLSAFYADGANTGCIRLSFSKDDATLVEGARRLCSL"
     atgcagagcg ccgccgcgcc ccgttcgaag ctgcccgacg tcggcacgac gatcttcacg        60
     gtcatcggcc agctcgccgc cgagcacgag gcgctgaatc tgtcgcaggg cgcgccgaat       120
     ttcgcgcccg atccggcgct cgtcgagcgc gtcgcccgcg cgatgcgaga cgggcacaac       180
     cagtacgcgc cgatggcggg catcgccgcg ctgcgcgagg cgctcgccgt gaagaccgag       240
     cgcctgtacg gcgagcgcta cgatccggac tccgaagtca ccatcgtcgc gagcgcgagc       300
     gaggggctct acgcggcgat cagcgcgctc gttcatccgg gcgatgaggt gatctacttc       360
     gagccgtcgt tcgacagcta cgcgccgatc gtccggctgc agggcgcgac gcccgtcgcg       420
     atcaggctgt cgcccgagcg ctttcgcgtg aactgggacg aggtggccgc gaagatcacg       480
     ccgcgcacgc ggatgctgat cgtcaacacg ccgcacaacc cgagcgcgac gatcctcggc       540
     gaggccgacg tcgcgcgtct cgcgcagctc gtcgcgggca ccgacatcgt ggtgctgtcc       600
     gacgaggtgt acgagcacgt cgtgttcgac ggcgcgcgcc atcacagcat ggcgcgcgat       660
     cgcgcgctcg ccgagcgcag cgtgatcgtg tcgtcgttcg gcaagtcgta tcacgtgacg       720
     ggctggcgcg tcggctactg cctcgcgccc gccgagctca cgcgcgagct gcgcaaggtc       780
     catcagttca tgacgttcgc ggccgatacg ccgatgcagc atgcgttcgc ggcggcgctc       840
     gcggagccgg cgagctatct cgagctcggc gcgttctacg agcgcaagcg cgacctgctc       900
     gtgcgcgagc tggccggctc gcgcttcgag ctgctgccga gcgagggttc gttcttcatg       960
     ctcgcgcgct tcgggcattt ttcggacgaa tcggacgccg acttcgtgct gcgtgcgatt      1020
     cgcgacgcac gcgtcgcgac gattccgctg tccgcgttct acgcggacgg cgcgaacacc      1080
     ggctgcatcc gtttgagctt ttcgaaggac gacgcgacgc tcgtcgaagg cgcgcgccgc      1140
     ctgtgcagcc tctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page