(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE151

CP000124.PE151       Location/Qualifiers
FT   CDS_pept        complement(163856..165646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50432"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXX9"
FT                   /protein_id="ABA50432.1"
FT                   /translation="MGVAVELVFQLRPQRGLLLQNGNARLRHRCRAQRARLDLAVQVEA
FT                   RRVRRPAAGARFAERERDQALFAIQTEERVPARVEVHAVDAAAAAVERIQLGHVTVRVL
FT                   GQPRDVARAEPRAERVEPRRGPRRARAFERFAERRVGGEEVIVGQFVELVAHLVGRPGH
FT                   DGRLLLVVVRLDQVSKDDFATCSGFGAARQIDCAAAAGLAPPPAAASRASELGGAAAGV
FT                   CSGFARARLREGDDSRDRGGRGRERRHVLRVFRRQGEPRRAHDPPLREDARDADARGRR
FT                   RAARRARPGGGGRAHRCAGRRDRAGPARVGRDVCDRAQGLADRRISSALRRLRRVVARC
FT                   ARRRERCAGRCAARRDRARRACAVLRVGVAIAADAGREGRCRATARRIASGGGGVSRGC
FT                   DGWRRGRRRGRRVRWASGVAGGFPCRWFCFRGASMRRRREARRRSAAIGGGHWRALVGA
FT                   VAAGISARFADALFDMHVGLGALHSSGVRVLLDDTPTRRHADGSTVPSVYESIPVSPMQ
FT                   SSRLTDSPIYRFASACRAAVPRPSGAERSIIGSRVHTTPTRRPPAVARPFEAARRRRHI
FT                   RRASRPTAVHSLEAHRRHKP"
     gtgggtgtcg ctgtagagct tgtctttcaa ttgcgcccac agcgcgggct ccttctgcag        60
     aacgggaatg ctcgcctgcg tcatcgttgc cgggcacagc gtgcccgcct cgatctggcc       120
     gtgcaggtag aagcccgccg cgttcgccgc ccagcggccg gcgcgcgatt cgcggaacgc       180
     gagcgagatc aggccctgtt cgcgatacag accgaggagc gcgtgccagc tcgggtggaa       240
     gtccacgcgg tcgatgcggc ggccgcggcg gtcgaacgca ttcagctcgg gcacgtgacg       300
     gttcgcgtcc tcggccagcc gcgcgatgtc gcgcgtgccg agccgcgcgc cgaacgcgtc       360
     gagccgcggc gcggcccacg acgcgcccgc gcgttcgagc gcttcgccga gcgccgggtc       420
     ggtggcgaag aggttatagt cggtcagttc gtcgaactgg ttgctcacct cgtgggtcga       480
     ccaggccatg atgggcgtct ccttcttgtc gttgttcggc tcgatcaggt tagcaaagat       540
     gacttcgcga catgttcagg tttcggcgcc gcccgacaaa tcgattgcgc agccgcagcc       600
     ggccttgcgc cgccgcccgc ggcagcgtcg cgcgcaagcg agctcggcgg cgctgcagca       660
     ggcgtttgtt cgggttttgc tcgagcgcgg ctacgcgaag gcgacgattc gcgagatcgc       720
     ggcggtcgcg ggcgtgagcg tcggcacgtt ctacgagtat ttcggcgaca aggagagcct       780
     cgccgcgctc acgatccacc attacgtgaa gacgctcgcg acgcggatgc gcgcggtcgt       840
     cgacgcgcgg cgcggcgagc gcggccgggc ggtggcggcc gcgctcatcg atgcgcaggt       900
     cgacgcgatc gagcaggacc cgcgcgtgtg ggccgcgatg tttgcgatcg agcgcaaggt       960
     ctcgccgatc gacgcatatc gtcggcatta cgacgactac gtcgcgttgt ggcgcgatgc      1020
     gctcgccggc gcgagcgatg cgccggccga tgcgcggctc gacgtgaccg cgcgcgtcgc      1080
     gcatgcgctg tgctacgggt gggtgtcgca atcgctgctg acgcagggcg cgaaggtcga      1140
     tgtcgcgcaa ctgcgagacg aattgcatcg ggcggcgggg gcgtatctcg cggctgcgat      1200
     ggatggcggc gcgggaggcg gcgcggccgg cgggtgaggt gggcgtctgg tgtcgctggc      1260
     ggttttcctt gccgctggtt ttgctttcga ggcgcgagca tgcggcgaag gcgcgaggcg      1320
     cgccggcgat cggcggcgat tggtggcggg cattggcggg cattggtggg cgcggtggcg      1380
     gcggggattt cggcgagatt cgcggacgct cttttcgaca tgcatgttgg gcttggggcg      1440
     ttgcattcgt cgggcgttcg ggttttgctt gacgacacgc cgacacgccg acacgcggac      1500
     ggatcaaccg ttccgtcggt ctatgaatcg attcccgtgt cgccgatgca gagcagccga      1560
     ctcaccgatt caccgattta ccgattcgcc agcgcatgcc gcgcggcggt gccgcggccc      1620
     agcggcgcgg agcgttcgat catcggctcc cgcgttcata ccaccccgac acgacggccg      1680
     cccgccgtcg cccggccgtt cgaagccgcg cggcggcgcc gccatatccg ccgcgcatcg      1740
     cgccccaccg ccgtccattc cctcgaagct caccgccgtc ataagccatg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page