(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE16

CP000124.PE16        Location/Qualifiers
FT   CDS_pept        25291..25887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0021"
FT                   /product="Phosphatidylethanolamine-binding protein"
FT                   /note="identified by match to protein family HMM PF01161;
FT                   match to protein family HMM TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50126"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB4"
FT                   /protein_id="ABA50126.1"
FT                   /translation="MRVGRRAVPRGSSRRLLSLALVCACALAPVGGSRALAEDAFMLTS
FT                   DDLHPGGRVGAPHVFNQGDCKGGNRSPQLAWRNPPPGTKGFAITMFDPDAPGRGWWHWA
FT                   VVGIPASVSSVPADASASGFLRKLGAAEARNDFGTDGYGGPCPPPGKPHRYVITVHALK
FT                   ATDLRVATGRPAQMFDHEIGTESIGSAQLVVTYGR"
     atgcgtgtgg gtcgccgagc cgtgccgaga ggttcgtccc gtcgtctgct ctcgctcgcc        60
     ctcgtctgcg cttgcgcgct cgcgccggtc ggcggctcac gcgcgctcgc cgaagacgcg       120
     ttcatgctga cgagcgacga tctgcacccc ggcggccgag tcggcgcgcc gcacgtgttc       180
     aaccagggcg actgcaaggg cggcaaccgc tcgccgcagc tcgcgtggcg caacccgccg       240
     cccggcacga aaggcttcgc catcacgatg ttcgaccccg acgcacccgg ccgcggctgg       300
     tggcactggg ccgtcgtcgg cattccggcg agcgtatcga gcgtgcccgc cgacgcgagc       360
     gcatccggct tcctgcgcaa gctcggcgca gccgaggcgc gcaatgattt cggcaccgac       420
     ggctacggcg gcccatgccc gccgcccggc aagccgcacc gctacgtgat caccgtccac       480
     gcgctgaagg caaccgacct gcgcgtcgcg acgggccgcc ccgcgcagat gttcgaccac       540
     gagatcggca ccgaatcgat cggctccgcc caactcgtcg tcacatacgg ccgctag          597
//

If you have problems or comments...

PBIL Back to PBIL home page