(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE167

CP000124.PE167       Location/Qualifiers
FT   CDS_pept        complement(179911..181593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48199"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW3"
FT                   /protein_id="ABA48199.1"
FT                   /translation="MAAHAICNRAYRRGARQRQSRLSAGRARIRAEQGRLQAVDRRGAL
FT                   QDVRVRGDDRGNRAGARDDARGRRAVRRARAEFAHGRDDERCGARGHAELRGRARARAG
FT                   GARFRAARRDRRDARLPRSDQHPVHERHDGQPEGRDAHAPQRRQQRALDRERDAADRGR
FT                   CDVHSGAALSLLRDGAVGARVRIGGREDGVSRRGVRAGCDARGGVRRALHRAARRADDV
FT                   HRRARSSGFRPFRPEHAAHRHHGGFAVPDRDDEARGREDAHVRGDDRLRDDGDEPRVVP
FT                   ERDDGFAREAHDDGRPDPAASGGEDRRRDGRDRARRRDGRAVHARLFGDARLLGRRGQN
FT                   ARGGGRWLDAHGRPRDARRRRLLQHRRAPEGHADSRRRERVPARDRGVSVPASEDPERA
FT                   GVRRARFEVRRGSMRVDRAARGRDDDGRRAARVLQRPDRALQGAALRALRRRTADDRDG
FT                   EGAEVRDARTNDRRTWFERAADGLTRRARFQWTKKSGLMSPLKTTRYGVSARRPKVERI
FT                   GMGRRRLQQGCPWEGIRYETDGLVIRACVRSHAAHETASVLKP"
     atggctgctc acgcaatttg caaccgcgcg tatcggcgcg gtgctcgtca acgtcaatcc        60
     cgcctatcgg ctggccgagc tcgaatacgc gctgaacaag gtcggctgca agctgttgat       120
     cgccgcggag cgcttcaaga cgtccgcgta cgcggagatg atcgcggaaa tcgcgccgga       180
     gctcgcgacg acgcgcgcgg gcgacgtgct gtgcgccgcg cgcgtgccga gtttgcgcac       240
     ggtcgtgacg atgagcgatg cggcgcacgc gggcatgctg agcttcgcgg acgtgctcgc       300
     gcgcgggcgg gcggcgctcg cttccgcgcg gctcgacgcg atcggcgcga cgctcgattg       360
     ccgcgatccg atcaacatcc agttcacgag cggcacgacg ggcagcccga agggcgcgac       420
     gctcacgcac cgcaacgtcg tcaacaacgc gcgctcgatc gcgaacgtga tgcggctgac       480
     cgaggccgat gcgatgtgca ttccggtgcc gctctatcac tgcttcggga tggtgctgtc       540
     ggtgctcgcg tgcgtatcgg cgggcgcgag gatggtgttt cccggcgcgg cgttcgagcc       600
     gggtgcgacg ctcgcggcgg tgtccgacga gcgctgcacc gcgctgcaag gcgtgccgac       660
     gatgttcatc gccgagctcg atcatccgga tttcgaccgt ttcgacctga gcacgctgcg       720
     caccggcatc atggcgggtt cgccgtgccc gatcgagacg atgaagcgcg tggtcgcgaa       780
     gatgcacatg tccgaggtga cgatcgccta cgggatgacg gagacgagcc ccgtgtcgtt       840
     ccagagcgcg acgacggatt cgctcgagaa gcgcacgacg acggtcggcc ggatccagcc       900
     gcatctggag gcgaagatcg tcgacgcgac gggcgcgatc gtgcccgtcg gcgagacggg       960
     cgagctgtgc acgcgcggct attcggtgat gctcggctat tgggacgacg aggccagaac      1020
     gcgcgaggcg gtggtcgatg gctggatgcg cacgggcgac ctcgcgacgc tcgacgaaga      1080
     aggcttttgc aacatcgtcg ggcgcctgaa ggacatgctg attcgcggcg gcgagaacgt      1140
     gtacccgcgc gagatcgagg agtttctgtt ccggcatccg aagatccaga gcgtgcaggt      1200
     gttcggcgtg cccgattcga agtacggcga ggaagtatgc gcgtggatcg tgctgcgcgc      1260
     gggcgagacg atgacggacg acgagctgcg cgagttctgc agcggccaga tcgcgcacta      1320
     caaggtgccg cgctacgtgc gcttcgtcga cgaactgccg atgaccgtga cggggaaggt      1380
     gcagaagttc gtgatgcgcg aacgaatgat cgacgaactt ggtttgagcg tgcagcagac      1440
     ggcttgacgc gccgcgcacg tttccaatgg acgaaaaaaa gcgggctgat gagcccgcta      1500
     aaaaccacac gctacggggt tagcgcgagg agaccaaagg tggaacgcat cggcatgggc      1560
     cgacgacgac tccaacaagg atgcccctgg gaagggattc ggtacgagac cgacgggctc      1620
     gtcattcgtg cttgtgtccg ctcacacgct gcacacgaga ccgcatccgt gttgaaaccg      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page