(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE169

CP000124.PE169       Location/Qualifiers
FT   CDS_pept        complement(180147..181877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0176"
FT                   /product="AMP-binding enzyme domain protein"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50786"
FT                   /db_xref="GOA:Q3JXW1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW1"
FT                   /protein_id="ABA50786.1"
FT                   /translation="MAADSGMGALIAPMHGLSYVRGPADVPLSDATIGQFLLDTVARFP
FT                   DRAAVVFREQGVRWTWREFADEVDALAAALIELGIARGDRVGIWSPNRAEWLLTQFATA
FT                   RIGAVLVNVNPAYRLAELEYALNKVGCKLLIAAERFKTSAYAEMIAEIAPELATTRAGD
FT                   VLCAARVPSLRTVVTMSDAAHAGMLSFADVLARGRAALASARLDAIGATLDCRDPINIQ
FT                   FTSGTTGSPKGATLTHRNVVNNARSIANVMRLTEADAMCIPVPLYHCFGMVLSVLACVS
FT                   AGARMVFPGAAFEPGATLAAVSDERCTALQGVPTMFIAELDHPDFDRFDLSTLRTGIMA
FT                   GSPCPIETMKRVVAKMHMSEVTIAYGMTETSPVSFQSATTDSLEKRTTTVGRIQPHLEA
FT                   KIVDATGAIVPVGETGELCTRGYSVMLGYWDDEARTREAVVDGWMRTGDLATLDEEGFC
FT                   NIVGRLKDMLIRGGENVYPREIEEFLFRHPKIQSVQVFGVPDSKYGEEVCAWIVLRAGE
FT                   TMTDDELREFCSGQIAHYKVPRYVRFVDELPMTVTGKVQKFVMRERMIDELGLSVQQTA
FT                   "
     atggcagcag attcaggcat gggcgcgctg atcgcgccga tgcacgggct ttcgtacgta        60
     cgcggcccgg cggatgtccc attgagcgac gcgacgatcg ggcagttcct gctcgatacg       120
     gtcgcccgct ttcccgatcg cgcggcggtc gtgttccgcg agcagggcgt gcgctggacg       180
     tggcgcgagt tcgcggacga agtcgacgcg ctcgccgccg cgctgatcga gctcggcatc       240
     gcgcgcggtg accgggtcgg catctggtcg ccgaaccgcg ccgaatggct gctcacgcaa       300
     tttgcaaccg cgcgtatcgg cgcggtgctc gtcaacgtca atcccgccta tcggctggcc       360
     gagctcgaat acgcgctgaa caaggtcggc tgcaagctgt tgatcgccgc ggagcgcttc       420
     aagacgtccg cgtacgcgga gatgatcgcg gaaatcgcgc cggagctcgc gacgacgcgc       480
     gcgggcgacg tgctgtgcgc cgcgcgcgtg ccgagtttgc gcacggtcgt gacgatgagc       540
     gatgcggcgc acgcgggcat gctgagcttc gcggacgtgc tcgcgcgcgg gcgggcggcg       600
     ctcgcttccg cgcggctcga cgcgatcggc gcgacgctcg attgccgcga tccgatcaac       660
     atccagttca cgagcggcac gacgggcagc ccgaagggcg cgacgctcac gcaccgcaac       720
     gtcgtcaaca acgcgcgctc gatcgcgaac gtgatgcggc tgaccgaggc cgatgcgatg       780
     tgcattccgg tgccgctcta tcactgcttc gggatggtgc tgtcggtgct cgcgtgcgta       840
     tcggcgggcg cgaggatggt gtttcccggc gcggcgttcg agccgggtgc gacgctcgcg       900
     gcggtgtccg acgagcgctg caccgcgctg caaggcgtgc cgacgatgtt catcgccgag       960
     ctcgatcatc cggatttcga ccgtttcgac ctgagcacgc tgcgcaccgg catcatggcg      1020
     ggttcgccgt gcccgatcga gacgatgaag cgcgtggtcg cgaagatgca catgtccgag      1080
     gtgacgatcg cctacgggat gacggagacg agccccgtgt cgttccagag cgcgacgacg      1140
     gattcgctcg agaagcgcac gacgacggtc ggccggatcc agccgcatct ggaggcgaag      1200
     atcgtcgacg cgacgggcgc gatcgtgccc gtcggcgaga cgggcgagct gtgcacgcgc      1260
     ggctattcgg tgatgctcgg ctattgggac gacgaggcca gaacgcgcga ggcggtggtc      1320
     gatggctgga tgcgcacggg cgacctcgcg acgctcgacg aagaaggctt ttgcaacatc      1380
     gtcgggcgcc tgaaggacat gctgattcgc ggcggcgaga acgtgtaccc gcgcgagatc      1440
     gaggagtttc tgttccggca tccgaagatc cagagcgtgc aggtgttcgg cgtgcccgat      1500
     tcgaagtacg gcgaggaagt atgcgcgtgg atcgtgctgc gcgcgggcga gacgatgacg      1560
     gacgacgagc tgcgcgagtt ctgcagcggc cagatcgcgc actacaaggt gccgcgctac      1620
     gtgcgcttcg tcgacgaact gccgatgacc gtgacgggga aggtgcagaa gttcgtgatg      1680
     cgcgaacgaa tgatcgacga acttggtttg agcgtgcagc agacggcttg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page