(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE188

CP000124.PE188       Location/Qualifiers
FT   CDS_pept        complement(201241..202692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0195"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47980"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU2"
FT                   /protein_id="ABA47980.1"
FT                   /translation="MHRETKFAGGERGDIRGTECPIESAVGFVPTALFICAFSAVYISL
FT                   SLNAVYHAAFDCRPLAPAGAHRCGLTRLSRAQRVRYTRHSPTRWSGNGRARDTETNSMI
FT                   GAGRFWGIGTANAWAAVSGVAFAEARTDFAACSDAASARFAAPPGLRAKDAIALPPREI
FT                   DRWATRAVALDDAADSARVPNGAYSHPSENHLDAPIGSAVSTPSSAMGGTAARLPARAM
FT                   SSMATASGLESFDAKRAFRGFETRPRDLSASAAIARHGFATRDRKTIAPAGLDAACSGS
FT                   ALAQVGGASVVKRIMLAEAGRRVCGDASVAPWASRAPSKRPDAVTPHAGPGARMLGALS
FT                   LKTPAAPSACCDAGATCRRAHGAAIEGLRHAHGAGGGGARRPAGLALVVDAFLTDSSFN
FT                   SLFAPVFRLAYEDAHDAGTTPTTGEHARSAAPLSAHGVRGASNRSRLGMPVFRRASPTS
FT                   CDGATDVAGVCRVFDRHAGLGEAFV"
     atgcaccgcg aaacgaaatt tgcaggtgga gaacgaggag acattcgagg cacagagtgc        60
     ccgatcgaaa gcgctgttgg attcgttcca acagcgcttt ttatttgtgc gttttcggcg       120
     gtgtacatat cgctttcgct aaacgcggtt tatcacgccg ccttcgattg ccgcccgctt       180
     gcgccggccg gcgcgcatcg ctgcgggcta acccggttgt cgcgcgcgca acgcgtccgc       240
     tacactcgcc attcgccgac ccgttggtcg gggaacggcc gagcgcgaga cacggagacg       300
     aactcgatga taggagcggg gcggttctgg ggaatcggta cggcgaacgc atgggcggcc       360
     gtttcgggcg tcgcgttcgc ggaggccagg accgacttcg ccgcttgctc cgatgctgcc       420
     tccgctcgct ttgccgcacc gccgggcctc cgcgcgaagg atgcgatcgc gttgccgccg       480
     cgcgaaatcg acaggtgggc aacgcgcgcc gttgcactcg acgatgcggc cgattcggcc       540
     cgcgtgccca acggcgctta ctcacacccg agcgaaaatc acctcgatgc gccgatcggc       600
     tcggccgtct ccacaccttc gtccgcaatg ggcggcacgg ccgcgcgctt gcccgctcgg       660
     gcgatgtcct cgatggcgac ggcttcgggt ctcgaatcgt tcgatgcaaa gcgcgccttt       720
     cggggctttg aaacacgacc acgcgatctc tctgcatcgg ccgcgatcgc caggcacggc       780
     ttcgcgacgc gcgacaggaa gacgattgcc cccgccgggc tcgacgcggc atgcagcggg       840
     agcgcgctgg cgcaagtcgg cggcgcgtcg gtggttaaac ggatcatgct tgccgaggct       900
     gggcggcgcg tgtgtggcga tgcgtcggtg gcgccttggg catcgcgcgc gccatcgaag       960
     cggcccgatg ccgtgacgcc gcacgcgggc ccaggtgccc gcatgctcgg cgcgctatcg      1020
     ctcaagacgc cggctgcgcc gtcggcgtgc tgcgatgccg gcgcgacttg ccggcgggcg      1080
     cacggcgcgg cgatcgaagg tctccggcat gcacacggcg caggcggcgg cggggcgcgt      1140
     cggcccgccg gcttggccct tgtcgtcgat gcgtttctca ccgattccag tttcaattcg      1200
     ttattcgcgc ctgtgttccg gctcgcgtat gaagatgcgc acgacgccgg cacgacgccg      1260
     acgaccggcg agcatgcgcg gagtgccgcg ccgctttctg ctcacggggt gcggggcgca      1320
     tcgaatcgca gcaggctcgg catgccggtg tttcgccgcg cgtcgcccac gtcgtgcgat      1380
     ggcgcgaccg atgttgccgg cgtgtgccgc gtattcgacc gacacgctgg cttgggcgaa      1440
     gcgttcgtgt ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page