(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE190

CP000124.PE190       Location/Qualifiers
FT   CDS_pept        complement(203860..204744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0197"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50431"
FT                   /db_xref="GOA:Q3JXU0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU0"
FT                   /protein_id="ABA50431.1"
FT                   /translation="MDIFGIPVSAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAMLAWMGLNYLGLPYWAMLVLAPVVVGLFGILIERSMLRWLYKLDHLYGLL
FT                   LTFGLTLVVEGVFRAIYGSSGQPYDVPALLEGATNVGFMFLPNYRAWVVVASLAVCLAT
FT                   WFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMVTLTYGFGVALAAFAGVLAAPVIQVS
FT                   PLMGQPMIITVFAVVVIGGMGSILGSIVTGLMLGVVEGLTRVFYPEASATVVFVIMAIV
FT                   LLIRPAGLFGKER"
     atggacatct tcggcattcc ggtgtcggcg atgctgagcc aattgttgct cggactcgtc        60
     aacggctcgt tctacgcgat cctgagcctc gggctcgcgg tgatattcgg gctgctcaac       120
     gtgatcaact tcgcgcacgg cgcgctcttc atgctgggtg cgatgctcgc gtggatgggg       180
     ctcaactatc tcggcctgcc gtactgggcg atgctcgtgc tcgcgcccgt cgtcgtcggg       240
     ctgttcggga tcctgatcga gcgctcgatg ctgcgctggc tctacaagct cgatcacctg       300
     tacggcctgc tgctgacgtt cgggctcacg ctcgtcgtcg aaggcgtgtt ccgcgcgatc       360
     tacggctcgt ccgggcagcc gtacgacgtg cccgcgctgc tcgagggcgc gaccaacgtc       420
     ggcttcatgt tcctgccgaa ctaccgcgcg tgggtcgtcg tcgcgtcgct cgcggtatgt       480
     cttgcaacct ggttcgtgat cgagaagacg cggctcggcg cctatctgcg cgcgggcacg       540
     gagaatccga agctcgtcga ggcgttcggc gtcaacgtgc cgatgatggt cacgctgacc       600
     tacggcttcg gcgttgcgct cgccgcgttc gctggcgtgc tcgcggcgcc cgtgattcag       660
     gtgtcgccgc tgatggggca gccgatgatc atcacggtgt tcgcggtcgt cgtgatcggc       720
     ggcatgggct cgattctcgg ctcgatcgtc acgggcctga tgctcggcgt ggtcgagggc       780
     ctgacgcgcg tgttctatcc ggaagcatcg gcgacggtcg tcttcgtgat catggcgatc       840
     gtgctgttga ttcgtccggc aggtttgttc ggcaaggaaa gatga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page