(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE196

CP000124.PE196       Location/Qualifiers
FT   CDS_pept        211706..212605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0203"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47766"
FT                   /db_xref="GOA:Q3JXT4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT4"
FT                   /protein_id="ABA47766.1"
FT                   /translation="MDLTLLRAFVAVAREGNLTRAAAQLHLTQPAVSLQIKNLQDLLGI
FT                   ALFVRTSRGLVLTRDGQALLPHAERALDAAADVKRAAAALRHEVRGRLRIGTILDPEFL
FT                   RLGGFLKRLVEAHPQIETALRHGMSGWVLDEVRARELDVGYYIGRPEEDDPRDAERFHT
FT                   VTLTQFRYRVLAPAGWKERVQRARTWRELAALPWIWTPAASAHQRLLSRRFADAGAQPV
FT                   KVAEVDQETSMLDLVKSGVGLTLARDSIALREAHAHALTIVEHVAVPAELTFVTLADRR
FT                   DEPAIAAALRLIDEQWAI"
     atggacctga ctctgctccg cgcgttcgtc gcggtcgcgc gcgagggcaa cctcacgcgc        60
     gcggcggcgc aactgcatct gacgcagccc gccgtcagcc tgcagatcaa gaatctgcag       120
     gatctgctcg gcatcgcgct gttcgtgcgc acgtcgcgcg ggctcgtgct cacgcgcgac       180
     ggccaggcgc tgctgccgca cgcggaacgc gcgctcgacg cggcggccga cgtgaagcgc       240
     gcggccgccg cgctcaggca cgaagtgcgc ggcaggctgc ggatcggcac gattctcgac       300
     cccgagttcc tgcggctggg cggcttcctg aagcggctcg tcgaagcgca tccgcagatc       360
     gagacggcgc tgcggcacgg catgtccggc tgggtgctcg acgaggtccg cgcgcgcgag       420
     ctcgacgtcg gctattacat cggccggccg gaggaggacg atccgcgcga cgccgagcgc       480
     tttcacacgg tgacgctcac gcagttccgc taccgggtgc tcgcgcccgc cggctggaag       540
     gagcgcgtgc agcgcgcgcg cacgtggcgc gagctcgcgg cactgccgtg gatctggacg       600
     cccgccgcat ccgcgcacca gcgcctcctg tcgcgccgct tcgccgatgc gggcgcgcag       660
     cccgtgaagg tcgccgaggt cgatcaggag acgtcgatgc tcgatctcgt caaatcggga       720
     gtcggcctga cactcgcgcg cgattcgatc gcgctgcggg aggcgcacgc gcacgcgctc       780
     acgatcgtcg agcatgtcgc ggtgcccgcc gagctcacgt tcgtcacgct cgccgatcgc       840
     cgcgacgaac cggcgatcgc cgccgcgctt cgcctcatcg acgagcaatg ggcgatatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page