(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE198

CP000124.PE198       Location/Qualifiers
FT   CDS_pept        complement(213627..214172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0205"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51160"
FT                   /db_xref="GOA:Q3JXT2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT2"
FT                   /protein_id="ABA51160.1"
FT                   /translation="MDKCDNCASKRIITRRIIMLELDHFDLALLDVLQRFGRATHQQLG
FT                   EEVPLSPSQIGRRLQRLEAAGVIDGYRVVLRPERLGLGVTAFTSLKLKHHGDSIIEQFQ
FT                   QQIDVLPEVLECHAVVGDADYLLRIVAPDLNALSSFVMKKLMRVPGVDSVRSNIVLTTF
FT                   KRNGPLPLGHLASGAPAA"
     atggataaat gcgataattg cgcatcaaaa cgcataatca cgcggagaat catcatgctg        60
     gaactcgatc acttcgattt ggcgctgctc gacgtgctgc agcgcttcgg tcgcgcgacg       120
     catcagcaac tgggcgaaga ggtgccgctg tcgccgtcgc agatcggccg gcggctgcag       180
     cggctcgagg cggcgggcgt gatcgacggc taccgcgtcg tgctgcggcc cgagcggctc       240
     gggctcggcg tcaccgcgtt cacgagcctg aagctcaagc atcatggcga ttcgatcatc       300
     gagcagttcc agcagcagat cgacgtgctg ccggaagtgc tcgaatgcca cgcggtggtt       360
     ggcgatgccg attatctgct caggatcgtc gcgccggatc tgaacgcgct gtcgtcgttc       420
     gtgatgaaga agctgatgcg ggtgccgggc gtcgacagcg tgcgctcgaa catcgtgctc       480
     acgacgttca agcgcaacgg gccgctgccg cttggccatc tggcctccgg tgcacccgcc       540
     gcctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page