(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE200

CP000124.PE200       Location/Qualifiers
FT   CDS_pept        215173..215544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0207"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="identified by match to protein family HMM PF01329"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47754"
FT                   /db_xref="GOA:Q3JXT0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXT0"
FT                   /protein_id="ABA47754.1"
FT                   /translation="MADTARRRANGRGRAAIGRGTKMIHKLTSEERKTQLESLHHWTAV
FT                   PGRDAIQRSLRFADFNEAFGFMTRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDANGLTE
FT                   RDIKLAHFIDEVGKHAKAA"
     atggccgata cggcgcgccg ccgcgcgaat gggcgcggcc gcgccgctat tggacgaggg        60
     acgaaaatga ttcacaagct cacatcggaa gaacgcaaga cgcagcttga aagcctgcac       120
     cactggaccg ccgttcccgg ccgcgacgcg atccagcgca gcctgcgttt cgccgatttc       180
     aacgaagcgt tcggcttcat gacgcgcgtc gcgatcaagg cgcaggaaat gaatcaccat       240
     cccgagtggt tcaacgtcta caaccgcgtc gatgtcacgc tctcgacgca cgacgccaac       300
     ggcctcaccg agcgcgatat caagctcgcg catttcatcg acgaagtggg caagcacgcg       360
     aaggctgcgt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page