(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE206

CP000124.PE206       Location/Qualifiers
FT   CDS_pept        complement(221626..222438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0213"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48405"
FT                   /db_xref="GOA:Q3JXS4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS4"
FT                   /protein_id="ABA48405.1"
FT                   /translation="MVGADGGAEIACRFAACASRRTCRTRSSGCALLRQRSRPDLPTNG
FT                   RLRKTAGNSEKTMSDGVYGNQAAGRVTHSLLRLSTAMRSQAWDWAEGAGLTPTQGEILV
FT                   LLLQRKGPMRLGEIARETQLTAATTSDAVSTLEHKGLVEKRRALDDGRALAVRLSARGR
FT                   TAAKKALQWPDFLSKAVGTLGGDEQGVLYRALLKTLRELQVNGDIPPHRMCVTCKHFQP
FT                   GKAARKPTYRCSLLDLTMADSDLRLDCAVHEEADVLTQKKTWKLFAQA"
     gtggttggcg ccgacggggg cgctgaaatc gcgtgcaggt tcgcagcgtg tgcctcgcgg        60
     cgaacatgtc ggacgcgctc gtccgggtgc gcccttttga gacagagatc gagacctgat       120
     ctccccacaa acggccgcct tcgaaagacg gccggcaaca gcgaaaagac tatgagcgat       180
     ggtgtttacg ggaaccaggc tgcggggcga gtgacccaca gcctgttgcg gttgagcacg       240
     gctatgcgga gccaggcatg ggattgggcg gaaggcgcgg ggttgacgcc gacgcagggt       300
     gaaatcctcg tgctgctgct ccagcgtaaa gggccgatgc gtctgggcga gattgcgcgc       360
     gaaacgcagt tgaccgccgc aacgacgagt gatgcggtga gcacgctcga gcacaagggg       420
     ctggtcgaaa agcggcgcgc gctcgacgac ggccgcgcac tcgcggtgcg cctgagcgcg       480
     cgtggccgca cggcggcgaa gaaggcgctg cagtggcccg acttcctgtc gaaggcggtc       540
     ggcacgctcg gcggcgacga gcagggcgtg ctgtaccgcg cgctgctgaa gacgctgcgt       600
     gagctgcagg tcaacggcga cattccgccg caccggatgt gcgtgacgtg caaacatttc       660
     cagccgggca aggcggcgcg caagccgacg taccgctgtt cgctgctcga tctgacgatg       720
     gcggacagcg atctgcgtct cgattgcgcg gtgcatgagg aagcggacgt cctgacgcag       780
     aagaagacct ggaagctctt cgcgcaggcg tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page