(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE208

CP000124.PE208       Location/Qualifiers
FT   CDS_pept        complement(223941..225155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0215"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50931"
FT                   /db_xref="GOA:Q3JXS2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXS2"
FT                   /protein_id="ABA50931.1"
FT                   /translation="MKSAFSFLPNWPLAPDAIFWAGFALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLVAGSFGFGVIDASTDDTSRLLVNVALGLLLFELGSRLDLRWIRRNPWLIASS
FT                   LAEATLTFVLVLAVLLLLKVPGMIALVLAAIAISTSPAMVIQLKTELRAEGQVSQRLIT
FT                   LSALNSVYAVVLTKLVTSWLHQEAYGNVFATILQPIYLLAGSFIVAYLFARACNYLFRH
FT                   VAATMRDEHSFVALFGLVVLAIAVAQVLKLSTMLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVILFVLTLTSFEGQDIAAGGLIAGALIATRFLAKLVGVLAFAKPSGLGVKQGI
FT                   ALGVSLVPMSALAYLLVDDTYQLYPNFDPRLRAVVMCSIVVLQLIGPLVVYRSLSAVGE
FT                   RRDAS"
     atgaagtcag cgttctcgtt tctacccaac tggccgctcg ccccggatgc gattttctgg        60
     gccggcttcg cgctgttcgc cgccgggctt tgcggcgagc tctgctatcg cgcatggcgc       120
     ctgccgcgca tcaccggcta cgcggtgatc ggcctcgtcg ccggctcgtt cggcttcggc       180
     gtgatcgacg cgagcaccga cgacacgtcg cggctcctcg tcaacgtcgc gctcggcctg       240
     ctgctgttcg agctcggcag ccggctcgac ttgcgctgga tccgccgcaa tccttggctc       300
     atcgcctcga gtctcgccga ggcgacgctc acgttcgtgc tcgtgctcgc ggtactgctg       360
     ctgctcaagg tgcccgggat gatcgcgctc gtgctggcgg cgatcgcgat ctcgacgtcg       420
     cccgcgatgg tgatccagct gaagacggag ctgcgcgcgg aagggcaggt ctcgcagcgg       480
     ctcatcacgc tgtccgcgct caacagcgtc tatgcggtcg tgctgacgaa gctcgtcacg       540
     agctggctgc atcaggaagc gtacggcaac gtgttcgcga cgatcctgca gccgatctat       600
     ctgctcgccg gctcgttcat cgtcgcgtat ctgttcgctc gcgcatgcaa ctatctgttc       660
     aggcacgtcg cggcgacgat gcgcgacgag cattcgttcg tcgcgctgtt cggccttgtc       720
     gtgctggcga ttgcggtcgc gcaggtgctc aagctgtcga cgatgctcac gctgctgctc       780
     gccggcatca tcgtaaagaa tctcgaggcg cgtccgcaat tgtggcccga gcacttcggc       840
     acggccggct ggcttctcac cgtgatcctg ttcgtgctga cgctcacgtc gttcgaaggg       900
     caggacatcg ccgcgggcgg gctcatcgcg ggcgcgctga ttgcgacgcg ctttctcgcg       960
     aagctcgtcg gcgtgctcgc gttcgcgaag ccgagcggcc tcggcgtgaa gcagggcatc      1020
     gcgctcggcg tctcgctcgt gccgatgtcg gcgctcgcgt acctgctcgt cgacgacact      1080
     taccagcttt atccgaattt cgatccgcgc ctgcgcgcgg tcgtcatgtg ctcgatcgtc      1140
     gtgctgcaac tgatcgggcc gctcgtcgtc tatcgcagcc tgtcggccgt cggcgagcgg      1200
     cgcgacgcga gctga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page