(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE22

CP000124.PE22        Location/Qualifiers
FT   CDS_pept        complement(32208..33146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0027"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48041"
FT                   /db_xref="GOA:Q3JYA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA8"
FT                   /protein_id="ABA48041.1"
FT                   /translation="MNTRDLQAFVAVVDSGSMVAAATRLHLTQPGLTRRVQNLETTLGV
FT                   PLLDRQSKPLKPTAAGREVYALARNVLRSVDELLAVAAPGSEPAGELRIGVPPFLSELA
FT                   LEGPIDRLRDAFPRLTLRITAGWSPALLENVERAVLDAAAVMMPASFPMPETLVSTLLG
FT                   VQPTVLVAARDFALPPGPLSLDALARYPWVLSQDGCGMRSALSRAFSAAGLPFDVAVEA
FT                   FGSDLQLSLVARGAGLGIASASALARSPHRNALRIVETADVEPGINVWLVHGVLPGRLM
FT                   RPVELLRERLAAVLEEERSRRLGGEADMPAN"
     ttgaatacgc gtgatcttca agctttcgtg gcggtcgtcg acagcggctc gatggtggcc        60
     gccgcgaccc ggctccatct gacgcagccc ggcctgacgc ggcgcgtgca gaacctcgag       120
     acgacgctcg gcgtgccgct cctcgatcgg cagagcaagc cgctcaagcc gaccgcggcg       180
     ggccgcgagg tctacgcgct cgcgcgcaac gtgctgcgct cggtcgacga actgctggcc       240
     gtcgcggcgc ccggtagcga gccggcgggc gaactgcgga tcggcgtgcc gccgtttttg       300
     tcggagctcg cgctcgaagg gccgatcgac cggctacgcg acgcgtttcc gcgcctcacg       360
     ctgcggatca cggccggctg gtcgccggcg ctgctggaaa acgtcgagcg cgcagtgctc       420
     gatgccgccg cggtgatgat gccggcaagc ttcccgatgc cggagacgct cgtgtcgacg       480
     ctgctcggcg tgcagccgac ggtgctcgtc gccgcgcgcg atttcgcgct gccgccgggg       540
     ccgctgtcgc tcgacgcgct ggcgcgctat ccgtgggtgc tgagccagga cggctgcggg       600
     atgcgctccg cgctgagccg cgcgttcagc gcggcggggc tgccgttcga cgtcgcggtc       660
     gaagcattcg gctcggatct gcagctctcg ctcgtcgcgc gcggcgcggg gctcggcatc       720
     gcatcggcgt ccgcgctcgc gcgcagcccg caccggaatg cgctgcggat cgtcgaaacg       780
     gcggatgtcg agccgggaat caacgtatgg ctcgtgcacg gcgtgctgcc gggccggctg       840
     atgcggcccg tcgagctgct gcgcgagcgg ctcgccgcgg tgctggagga ggaaagaagc       900
     cggcggttgg gcggcgaagc ggacatgccg gccaattag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page