(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE230

CP000124.PE230       Location/Qualifiers
FT   CDS_pept        248858..249328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0237"
FT                   /product="LrgA family protein"
FT                   /note="identified by match to protein family HMM PF03788"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51152"
FT                   /db_xref="GOA:Q3JXQ0"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ0"
FT                   /protein_id="ABA51152.1"
FT                   /translation="MSRISATAATATRPTTAAPARVGRAARVALQTAALGALWAAIDWT
FT                   VRAFGVPVPSGVVGLAVLLALLLSGRVAPGWVKDGANWLLSDMLLFFIPATVAAVQYGG
FT                   LFKADGWRLALVVVAGTTFVMLSVAIAVDVAAGFERRLAVMRVRAGRRRARA"
     atgagcagga tttcggctac ggcggcaacc gcgactcgcc cgacgacggc ggcgcccgcg        60
     cgcgtgggcc gcgcggcgcg cgtcgcgttg cagacggccg cgctcggcgc gctgtgggcg       120
     gcgatcgact ggacggtgcg cgcgttcggc gtgccggtgc cgtccggcgt ggtcggcctc       180
     gcggtgctgc tcgcgctgct gctgtccggc cgcgtcgcgc ccggctgggt gaaggacggc       240
     gcgaactggc tgctgtccga catgctgctc ttcttcatcc cggcgaccgt cgcagccgtc       300
     cagtacggcg gcctcttcaa ggcggacggc tggcggctcg cgctcgtcgt cgtcgccgga       360
     accacgttcg tgatgctgtc ggtggcgatc gcggtcgacg tcgcggcggg cttcgagcgg       420
     cggctcgcgg tgatgcgcgt gcgtgccggc cgccgccgcg cgcgggcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page