(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE231

CP000124.PE231       Location/Qualifiers
FT   CDS_pept        249358..250119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0238"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04172"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48387"
FT                   /db_xref="GOA:Q3JXP9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP9"
FT                   /protein_id="ABA48387.1"
FT                   /translation="MPFVDGTGSEGRIMTTPDLSFLTAPSSAAISAGCFALTIALYFAS
FT                   KRLYACRKTLFFSPLVLVPAVLVAFVALTGIPYAVYFRDTRWLMWLLGPATIAFAVPIY
FT                   EYRELMKRHWFSLAVGVVVGIAVAICGSLLLSKLLHLSPELQRSLVTRSVSTPFALAVS
FT                   DRIHAPRDLTALFVIATGICGMLVGEFVLALVPLRSRLARGALFGAAAHAVGTAKAREI
FT                   GSEEGVVSSLTMMIAGVAMVLIAPLLTLLPI"
     atgccattcg ttgatggcac cggttccgaa ggccgcatca tgacgacgcc cgatctctcg        60
     tttctcaccg cgccttcgag cgccgcgatt tccgccggct gcttcgcgct gacgatcgcg       120
     ctctacttcg cgtcgaagcg gctctacgcg tgccgcaaga cgctgttctt ctcgccgctc       180
     gtgctcgtgc cggccgtgct cgtcgcgttc gtcgcgctga cgggcattcc gtacgcggtg       240
     tactttcgcg acacgcgctg gctgatgtgg ctgctcggcc cggcgacgat cgcgttcgcc       300
     gtgccgatct acgaataccg cgagctgatg aagcgccact ggttctcgct cgcggtgggc       360
     gtcgtcgtcg ggatcgcggt cgcgatctgc ggctcgctgc tgctgtcgaa gctgctgcat       420
     ctgtcgcccg agctgcagcg cagcctcgtc acgcgctcgg tgtcgacgcc gttcgcgctc       480
     gccgtctccg accggatcca cgcgccgcgc gatctcaccg cgctcttcgt gatcgcgacc       540
     gggatttgcg ggatgctcgt cggcgaattc gtgctcgcgc tcgtgccgct gcgctcgcgg       600
     ctcgcgcgcg gcgcgctgtt cggcgcggcc gcgcatgcgg tgggcaccgc gaaggcgcgc       660
     gagatcggta gcgaggaagg cgtcgtgtcg agcctcacga tgatgatcgc gggcgtcgcg       720
     atggtgctga tcgcgccgtt gctgacgttg ctgccgatct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page