(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE244

CP000124.PE244       Location/Qualifiers
FT   CDS_pept        258016..259029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47675"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN6"
FT                   /protein_id="ABA47675.1"
FT                   /translation="MRTTLRALSLAAVAAGLSFGFAAQPAFADDGGKITIMVGGITKLI
FT                   YLPARLTQELGYFKAEGLDVELQSQPAGVDAENELLAGAVQGVVGFYDHTIDLQSKGKD
FT                   VKAIAVLGQVPGEVEMVSTKAAGAIKSMADVKGKTLGVTGLGSSTSFLTQYLAQQHGIA
FT                   ANQYTMLPVGADASFIAAVKQGRIDAGMTTEPTVSVLEKNGDAKVLVDLRTLDGTRAAL
FT                   GGTYPAASLYVQSAWADTHKAQAAKLAHAFARTMQFIHTHSAEEIAAKMPADYQKDKAL
FT                   YVSALKASLPMYTPDGRMPADGPATVLKVLSAFNPSVKGKHIDLSKTYTNDFVSAK"
     atgcgcacca ctcttcgcgc gctcagcctg gccgcggtcg cggccggcct gtccttcggc        60
     ttcgctgcgc agccggcctt cgccgacgac ggcggcaaga tcacgatcat ggtgggcggc       120
     atcacgaagc tcatctacct gcccgcgcgt ctcacgcagg agctcggcta cttcaaggcc       180
     gaggggctcg acgtcgaact gcagtcgcag ccggccggcg tcgatgccga gaacgaactg       240
     ctcgcgggcg cggtgcaggg cgtcgtcggc ttctatgatc atacgatcga cctgcagagc       300
     aagggcaagg acgtgaaggc gatcgccgtg ctcggccagg tgcccggcga agtcgagatg       360
     gtgtcgacga aggcggcggg cgcgatcaaa tcgatggccg acgtgaaggg caagacgctc       420
     ggcgtgacgg gcctcggctc gtcgacgagc tttctcacgc agtacctcgc gcagcagcac       480
     ggcatcgccg cgaaccagta cacgatgctg cccgtcggcg ccgacgcgag cttcatcgcg       540
     gccgtcaagc aaggccgcat cgatgcgggg atgacgaccg agccgaccgt gtcggtgctc       600
     gagaagaacg gcgacgcgaa ggtgctcgtc gatctgcgca cgctcgacgg cacgcgcgcc       660
     gcgctcggcg gcacgtatcc ggcggcgagc ctgtacgtgc agtccgcgtg ggccgatacg       720
     cacaaggcgc aggccgcgaa gctcgcgcat gcgttcgcgc gcacgatgca gttcatccac       780
     acgcacagcg cggaggagat cgccgcgaag atgcccgccg actatcagaa ggacaaggcg       840
     ctctacgtga gcgcgctgaa ggcctcgctg ccgatgtaca cgcccgacgg caggatgccc       900
     gccgacggtc cggcgacagt gctcaaggtg ctctccgcgt tcaatccgtc ggtgaagggc       960
     aagcacatcg atctgtcgaa gacttatacc aacgatttcg tgagcgcgaa ataa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page