(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE246

CP000124.PE246       Location/Qualifiers
FT   CDS_pept        259938..260786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0253"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49705"
FT                   /db_xref="GOA:Q3JXN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN4"
FT                   /protein_id="ABA49705.1"
FT                   /translation="MTLPTPLGTLTSLEDEERAAQRRLRRRRQLIVGLRIAVLVAVLGG
FT                   WEIAARLKWIDPFFFSMPSLIAAQIQDWFVNGTSQGPLLLQVWVTLEETIAGFLIGSVA
FT                   GIFCGIVLGRNKLLADVFGLYIQIANSIPRVVLGSVFVIALGLGMASKIALAVVMVFFV
FT                   VFGNAFQGVREADRYLIANAQILGASRRQITTSVVIPSALSWILASLHVSFGFALVGAV
FT                   VGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADFLLTRLEKRLLKWRPAA
FT                   F"
     atgacgcttc cgacgccgct tggcaccctc acctcgctcg aagacgaaga gcgcgccgcg        60
     cagcgccggc tgcggcggcg ccggcaactg atcgtcgggc tgcgcatcgc ggtgctcgtc       120
     gccgtgctgg gcggctggga gatcgcggcg cgcctgaagt ggatcgaccc gttcttcttc       180
     tcgatgccgt cgctgatcgc cgcgcagatc caggactggt tcgtcaacgg cacgtcgcaa       240
     ggcccgctgc tgctgcaggt atgggtgacg ctcgaggaga cgatcgcggg cttcctgatc       300
     ggctcggtcg cgggcatctt ctgcgggatc gtgctcgggc gcaacaagct gctcgccgac       360
     gtgttcggcc tctacatcca gatcgcgaac tcgattccgc gcgtcgtgct cggctcggtg       420
     ttcgtgatcg cgctcggcct cgggatggcc tcgaagatcg cgctcgccgt cgtgatggtg       480
     ttcttcgtcg tgttcggcaa cgcgttccaa ggcgtgcgcg aggcggaccg ctacctgatc       540
     gcgaacgcgc agatcctcgg cgcgtcgcgc cggcagatca cgacctccgt cgtgattccg       600
     tccgcgctca gctggattct cgcgagcctg cacgtgagct tcggcttcgc gctcgtcggc       660
     gcggtcgtcg gggaatttct gggttccaag caaggcatcg gcctgctaat ctcgaccgca       720
     cagggcgcgt tcaacgcgag cggcgtgttc gccgcgatga tcgtgctcgc cgtcgtggcg       780
     ctcgccgccg acttcctgct gacccggctc gaaaagcggc tcctgaagtg gcggcccgcc       840
     gcgttctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page