(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE247

CP000124.PE247       Location/Qualifiers
FT   CDS_pept        260864..262243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0254"
FT                   /product="sensor kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48070"
FT                   /db_xref="GOA:Q3JXN3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN3"
FT                   /protein_id="ABA48070.1"
FT                   /translation="MSHSLRGRLLWWLLLPLAVFVAIAGAMSYDTARKTADLVQDGALV
FT                   ASARVIAEDVDWEGGALVANVPPAALELFASPAQDHVYYKVRTGGGRLLAGNPDLDGPA
FT                   APAASGAQPVLFDTALGGLAIRAVAYTRELYNAGNTETVTVVVGKTQTSRQMMIAAIWH
FT                   PQLWRLALMLALAMALVYLGLTFELRPLMKLKEDVADRGPMELEPIRTERLHFELRPIV
FT                   DAINQCIARLNLHAATQRRFIADAAHQLRTPIAVIDTQIQCARQRENGDAALAALLASM
FT                   QRSSRRMADVTDKLLLLAHAEAASPARLAARVDIAAVVSGVLEEAIVLAERRRIDLGAE
FT                   LDDDLQVAGSESLLSALLMNLVDNAVRYAHEGGRVTVSARRDGDAVVLEVVDDGPGIPA
FT                   EARPHVFKRFYRVARDEEGTGLGLAIVEEIAQSHGGAVSLATGPGNRGVRMTVRLPAYR
FT                   N"
     atgtcgcaca gcctgcgcgg ccgactgctt tggtggctgc tgctgccgct cgccgtgttc        60
     gtcgcgatcg cgggcgcgat gtcgtacgac accgcgcgca agacggccga tctcgtgcag       120
     gacggcgcgc tcgtcgcgtc cgcgcgcgtg atcgccgagg acgtcgattg ggaaggcggc       180
     gcgctcgtcg cgaacgtgcc gcccgccgcg ctcgagctgt tcgcatcgcc cgcgcaggat       240
     cacgtgtact acaaggtgcg cacgggcggc gggcggctgc tcgccggcaa tcccgatctc       300
     gacggcccgg ccgcgccggc cgcgtccggc gcgcagccgg tgctgttcga cacggcgctc       360
     ggcgggctcg cgattcgcgc ggtggcatac acgcgcgagc tgtacaacgc gggcaacacg       420
     gaaacggtga cggttgtcgt cggcaagacg cagacctcgc ggcagatgat gatcgcggcg       480
     atctggcatc cgcagctctg gcggctcgcg ctgatgctcg cgctcgcgat ggcgctcgtc       540
     tatctcgggc tcacgttcga gctgcggccg ttgatgaagc tgaaagaaga cgtcgccgac       600
     cgcgggccga tggagctcga gccgatccgc accgagcggc tgcatttcga gctgcggccg       660
     atcgtcgacg cgatcaacca gtgcatcgcg cggctgaacc tgcacgcggc gacgcagcga       720
     cgcttcatcg ccgacgccgc gcaccagctg cgcacgccga tcgcggtgat cgacacgcag       780
     atccagtgcg cgcggcagcg cgagaacggc gacgcggcgc tcgccgcgct gctcgcgtcg       840
     atgcagcgca gcagccgccg gatggcggac gtcaccgaca agctgctgct gctcgcgcac       900
     gcggaagccg cgtcgcccgc gcggctcgcc gcgcgcgtcg acatcgcggc cgtcgtgtcg       960
     ggcgtgctcg aggaggcgat cgtgctcgcc gagcggcggc gcatcgatct cggcgcggag      1020
     ctcgacgacg atctgcaggt ggccggcagc gaaagcctgc tgtcggcgct gctgatgaat      1080
     ctcgtcgaca acgcggtgcg ctatgcgcat gaaggcggac gcgtgacggt gagcgcgcgg      1140
     cgcgacggcg acgcggtggt gctcgaggtc gtcgacgacg gcccgggcat cccggccgag      1200
     gcgcggccgc acgtgttcaa gcgcttctat cgcgtcgcga gggacgagga aggcacgggc      1260
     ctcgggctcg cgatcgtcga ggagatcgcg cagtcgcacg gcggcgcggt gtcgctcgcc      1320
     acaggccccg gcaaccgggg cgtgaggatg accgtgcgac tgcccgccta tcgcaattga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page