(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE25

CP000124.PE25        Location/Qualifiers
FT   CDS_pept        complement(35368..37179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0030"
FT                   /product="dehydrogenase"
FT                   /note="identified by match to protein family HMM PF02826;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49487"
FT                   /db_xref="GOA:Q3JYA5"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA5"
FT                   /protein_id="ABA49487.1"
FT                   /translation="MRLRCASDACRCTRDASVRASARRRLRLRHVLDQRAHAPPVRAFP
FT                   EHAAAYVAGDEARVTLQHALRRAAGSLGGIDAPQRRIARQAQPERPRAAGEVEPIEQLL
FT                   QLRLRLQRAHVAAVRDRAALEQFAIAREDDSRFARGDRLDQLVRVVVVVQRVEAGEPQQ
FT                   LREPAEVRIGDEARDAQRRGAHAQQRADVDRLEARVDGDAVAFFEHVAERCRFAVDEDQ
FT                   LDFGMRHAERFDRMLDARAAHARVREFATAQRPREEIVQLLVEAESHGDHRLSIAPPRA
FT                   CRTSRDARRETANVARLCFTRAFDGLDEYKEHDMDIGFIGAGEMGSAIAGNLLKAGHRV
FT                   RVWNRSAERVAPLVALGAQQVATVADAFAGDAVFSMLADDAAARDVFDAALLEQAPRGL
FT                   IHVNMATISVALAEQLAHAHAQRAIHYVAAPVMGRPHVAAAARLTIIAAGPAEAIDRMQ
FT                   PAFDAIGQRTWRLGSLPQHANAVKIAANFTIASAIETMGEAGALLAAHGVAMNDYLDVI
FT                   TNSVFPGPVYQGYGAMIAESRYEPALFKARLGLKDVRLALEAGDALSVPLPVASVVRDS
FT                   LIEAVAHGHGDKDFAVLGQVAARRAGR"
     atgcgtctcc gatgcgcctc cgatgcgtgc cgttgcacgc gcgacgcatc ggtgcgcgca        60
     tcagcccggc ggcggcttcg gttgcgacac gtgctcgatc agcgcgcgca tgcgccgcca       120
     gtgcgagcct tcccagaaca cgcggcggca tacgtcgcag gtgacgaagc gcgtgtgacg       180
     ctgcagcacg ccctgcggcg cgcggccggc agcctcggcg ggatcgatgc gccgcagcgg       240
     cgcattgcac gacaggcaca gccggaaagg ccgcgcgctg ccggcgaggt cgagccgatc       300
     gaacagctcc tgcaattgcg cctgcggctt cagcgcgcgc acgtagcagc cgtgcgtgat       360
     cgtgcggcgc ttgagcagtt cgcgatcgcg cgtgaggacg attcgcgctt cgcgcgcggc       420
     gatcgtctcg atcagctcgt ccgggtagtg gttgtcgtac agcgtgtcga agccggcgag       480
     ccgcagcaat tgcgcgagcc cgccgaggtg cgcatcggcg atgaagcgcg tgacgcgcag       540
     cggcgcggcg cgcacgcgca gcaacgggcg gatgtcgatc gcctcgaagc tcgggtagac       600
     ggcgacgcgg tcgccttctt cgagcacgtg gctgaacggt gtcgattcgc cgttgacgag       660
     gatcagctcg acttcggtat gcggcacgcc gagcgcttcg atcgcatgct tgacgctcgc       720
     gccgcgcatg cacgcgtgcg cgaattcgcg acggcgcagc ggccgcgcga ggaaatcgtt       780
     cagctcctcg tagaagcgga aagtcacggt gaccatcggt tgagtatcgc accgccgcgc       840
     gcttgccgca catcgcgcga tgcccgccgc gaaacggcaa atgtcgcgcg cctgtgcttt       900
     actcgtgctt tcgacggatt agacgaatac aaggagcacg acatggacat cggatttatc       960
     ggtgcgggcg agatgggcag cgcgatcgcg gggaatctgc tgaaggcggg gcatcgcgtt      1020
     cgggtgtgga accgatcggc cgaacgtgtc gcgccgctcg tcgcgctggg cgcgcagcag      1080
     gtcgcgacgg tggccgacgc gttcgcgggc gacgcggtgt tctcgatgct cgccgacgat      1140
     gcggccgcgc gcgacgtgtt cgacgcggcc ctcctcgagc aagcgccgcg cgggctcatt      1200
     cacgtgaaca tggcgacgat ctccgtcgcg ctcgccgagc agctcgcgca tgcgcacgcg      1260
     cagcgagcca tccattacgt cgcggcgccc gtgatgggcc gtccgcacgt cgcggcggcc      1320
     gcgcgcctca cgatcatcgc ggccgggccc gcggaggcga tcgaccggat gcagccggca      1380
     ttcgacgcga tcggccagag gacgtggcgg ctcggctcgc tgccgcagca tgcgaacgcg      1440
     gtgaagatcg cggcgaactt cacgatcgcg tcggcgatcg agacgatggg cgaagcgggc      1500
     gcgctcctcg ccgcgcacgg tgtcgcgatg aacgactatc tcgatgtgat caccaacagc      1560
     gtgtttcccg gccccgttta tcagggctac ggcgcgatga tcgccgagtc gcgctacgaa      1620
     ccggcgctct tcaaggcgcg gctcggcctg aaggacgtgc ggctcgcgct cgaggcgggc      1680
     gacgcgctgt cggtgccgct gcccgttgcg agcgtcgtgc gcgatagcct gatcgaagcg      1740
     gtcgcgcacg gccacggcga caaggatttc gcggtgctcg gccaggtcgc ggcgcgccgc      1800
     gcggggcgct ga                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page