(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE269

CP000124.PE269       Location/Qualifiers
FT   CDS_pept        complement(281106..281903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0276"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48685"
FT                   /db_xref="GOA:Q3JXL1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL1"
FT                   /protein_id="ABA48685.1"
FT                   /translation="MHTFNDKVALITGGGTGIGAAVARKFVEAGGRVVLLGRRREPLDA
FT                   VAKPLGAAAIAVAGDAADAHDVRRALDDARAAFGRVDVLVANAGGHGVGSALDTDDASW
FT                   AQSTRVNLDTAFVCARELLPELIERRGSIVILSSLAGHFAGPNVIGYVTTKHALIGLTR
FT                   SLARDYGRAGVRVNAVCPGWVRTAMADEQMDALRDAHGLATREDAYRLVTRDVPLGRPA
FT                   QPDEVADTVLYLASPYASMVTGTSLLVDGGASAVDLPTIEFAR"
     atgcatacgt tcaacgacaa ggtcgcgttg atcacgggcg gcggcacggg catcggcgcg        60
     gccgtcgcgc gcaagttcgt cgaagcgggc ggcagggtcg tgctgctcgg ccgccgtcgc       120
     gagccgctcg acgcggtcgc gaagccgctc ggcgccgccg cgatcgcggt cgcgggcgac       180
     gcggccgatg cgcatgacgt gcgccgcgcg ctagacgacg cgcgcgcggc gttcgggcgc       240
     gtcgacgtgc tggtcgcgaa cgcgggcggc cacggcgtcg gcagcgcgct cgataccgac       300
     gacgcgtcgt gggcgcaatc gacgcgcgtg aacctcgaca ccgcgttcgt ctgcgcgcgc       360
     gagttgctgc ccgagctgat cgagcggcgc ggcagcatcg tgatcctgtc gtcgctcgcc       420
     ggccatttcg cggggccgaa cgtcatcggc tacgtgacga ccaagcacgc gctgatcggc       480
     ctcacacgct cgctcgcgcg cgactacggc cgtgccggcg tgcgcgtgaa cgcggtgtgc       540
     ccgggctggg tgcgcaccgc gatggccgac gagcagatgg acgcgctgcg cgacgcgcac       600
     gggctcgcga cgcgcgagga cgcctaccgg ctcgtcacgc gcgacgtgcc gctcggccgc       660
     ccggcgcagc ccgacgaagt cgccgacacg gtgctgtacc tggcgtcgcc gtatgcatcg       720
     atggtcacgg gcacgtcgct gctcgtcgac ggcggcgcat ccgccgtcga tctgccgacg       780
     atcgaattcg cgcgctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page