(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE272

CP000124.PE272       Location/Qualifiers
FT   CDS_pept        284385..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0279"
FT                   /product="PadR-like family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49170"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK8"
FT                   /protein_id="ABA49170.1"
FT                   /translation="MKTQLKKGALDMCVLAMLARRDSYAYELVSTLAETMEISEGTIYP
FT                   LMRRLQAEAWVTTYLVESTSGPPRKYYSITDAGRASLRQMEDEWRSFVDEVNGVLALHG
FT                   TRADGEERQ"
     atgaagaccc agttgaagaa aggcgcgctc gatatgtgcg tgctcgccat gctggcgcgg        60
     cgggacagct acgcgtacga gctcgtgtcg acgctcgccg aaacgatgga gatcagcgaa       120
     ggcacgatct acccgctgat gcggcgcctg caggccgagg cctgggtgac gacctacctc       180
     gtcgaatcga cgtcggggcc gccgcgcaag tactactcga tcaccgacgc cgggcgcgcg       240
     agcctgcggc agatggaaga cgagtggcgg agtttcgtcg acgaagtcaa cggcgtgctg       300
     gcgttgcacg gcacgcgagc ggacggagag gaacggcaat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page