(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE274

CP000124.PE274       Location/Qualifiers
FT   CDS_pept        284723..285910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0280"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50184"
FT                   /db_xref="GOA:Q3JXK6"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK6"
FT                   /protein_id="ABA50184.1"
FT                   /translation="MKQDAFIQRLRQALGSLPKRDVDEIVADYREYIGDALSAGRTEED
FT                   VIAALGEPEKLARELKAQANFRQWEERRSFGNLMRVVGSIAGLGLLHLVLLVPFLLYML
FT                   VLTLGYVFFGALTVAGLVTLVAFGSHYVFGTPVPGVLPFGGGAAQLGAAGASGKADGKG
FT                   ATDGKAAQTGKIAQDPKSASAAAADALNDAKELRVEGERYVLDLHDGSRVSIVTRKGVI
FT                   DARKQGGKLSIDATGDGARELLTTGKDDTLGIARADVIALDLKSANGDQMTVANTGGSV
FT                   PGVNVPGIAGGNVQMTPDGRGGMNLSVTNGENSVSIVGGRITVDNGKQHVSVAAPAGFA
FT                   LGGIAFGYGLAMLPIGIVGLLVCVWLTRVTWRALGRYVRRRIDAVSAKLERERAN"
     atgaagcagg acgcattcat ccagcggttg cggcaggcgc tcggcagcct gccgaaacgg        60
     gacgtcgacg agatcgtcgc cgattaccgc gagtacatcg gcgacgcgct ctcggccggg       120
     cgcaccgagg aagacgtgat cgccgcgctc ggtgaaccgg agaagctcgc gcgcgagctg       180
     aaggcgcagg cgaatttccg ccaatgggag gagcggcgct cgttcggcaa tctgatgcgc       240
     gtggtcggct cgatcgcggg cctcgggctg ctgcacctgg tcctgctcgt gccgttcctg       300
     ctgtacatgc tcgtgctgac gctgggctac gtgttcttcg gcgcgctgac ggtggcgggc       360
     ctcgtcacgc tcgtcgcgtt cggcagtcac tacgtgttcg gcacgcccgt gccgggcgtc       420
     ctgccgttcg gcggcggcgc ggcgcagctc ggcgcggccg gcgcttcggg caaggcggac       480
     ggcaagggcg cgacggacgg caaggccgcg cagaccggca agatcgcgca ggatccgaag       540
     agcgcgagcg ccgcggccgc cgatgcgctg aacgacgcga aggagctgcg tgtcgagggc       600
     gagcgctacg tgctcgactt gcacgacggc agccgcgtgt cgatcgtcac gcgcaagggc       660
     gtgatcgatg cgcgcaagca gggcggcaag ctgtcgatcg acgcgacggg tgatggcgcg       720
     cgcgagctgc tcacgacggg caaggacgac acgctcggca tcgcgcgcgc cgacgtgatc       780
     gcgctcgatc tgaagagcgc gaacggcgac cagatgacgg tggcgaacac gggcggatcg       840
     gtgccgggcg tgaacgtgcc cggcatcgcg ggcggcaacg tgcagatgac gccggatggc       900
     cgcggcggca tgaacctgtc ggtgacgaac ggcgagaatt cggtatcgat cgtcggcggc       960
     cggatcaccg tcgacaacgg caagcagcac gtgagcgttg ccgcaccggc cgggttcgcg      1020
     ctcggcggca tcgcgttcgg ctacgggctc gcgatgctgc cgatcgggat cgtcgggctg      1080
     ctcgtgtgcg tctggttgac gcgggtcacg tggcgcgcgc tcgggcggta cgtgaggcgg      1140
     cggatcgatg cggtatcggc gaagctcgag cgggagcggg cgaactga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page