(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE276

CP000124.PE276       Location/Qualifiers
FT   CDS_pept        complement(287599..288435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49201"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK4"
FT                   /protein_id="ABA49201.1"
FT                   /translation="MTQPTARHLILDLLVAKDGEPLQVREAIIACRLFGLTENSVRVAL
FT                   ARLAAESLVEGAERGSYRLGPSAVELSEELTAWRTVESRLRRWSGAYLMVSCISLGRVD
FT                   RTALARRERALEMLGFREWDKSLYVRPDNIAGNVDSVRRRLTKLGVEPAAAVFVAMGFD
FT                   APQEARIRALWDGDALSDTYRTLGAQLEDWLARAPELDLDVAAREAFLLGGKAIRQVVF
FT                   DPLLPEPFVDVAARAAFIECARRYVGAGHRIWRALLDSEHPSAPGAARDAIVGHLH"
     atgacgcaac ctaccgcgag acatctgatc ctcgatttgc tggtcgccaa ggacggcgag        60
     ccgctgcaag tgcgcgaagc gatcatcgcg tgccggctgt tcggcctcac cgaaaacagc       120
     gtgcgagtcg cgctcgcgcg gctggcggcc gaatcactcg tcgagggggc ggagcgcggc       180
     agctaccggc tcgggccgtc ggccgtcgag ctgtccgagg agttaaccgc gtggcgcacc       240
     gtcgaatcgc ggctgcgccg ctggagcggc gcgtacctga tggtgtcgtg catctcgctc       300
     ggccgggtcg accgcaccgc cctcgcccgc cgcgagcgcg cgctcgagat gctcggcttc       360
     cgcgaatggg acaagagcct gtacgtacgc ccggacaaca tcgccggcaa tgtcgactcg       420
     gtgcgccggc ggctgaccaa gctcggcgtc gagccggcgg cggccgtgtt cgtcgcgatg       480
     ggcttcgacg ccccgcagga agcgcgcatc cgcgcgctgt gggacggcga cgcgctgtcg       540
     gatacgtacc gcacgctcgg cgcgcagctc gaagactggc ttgcgcgcgc gccggagctc       600
     gatctcgacg tggccgcgcg cgaggcgttc ctgctcggcg gcaaggcgat ccggcaggtc       660
     gtcttcgatc cgctgctgcc ggagccgttc gtcgacgtcg ccgcgcgcgc ggcgttcatc       720
     gaatgcgcgc ggcgctacgt cggcgcgggc caccggatct ggcgcgccct cctcgacagc       780
     gagcatccgt ccgcgccggg cgcggcgcgc gacgcgatcg tgggccacct gcactag          837
//

If you have problems or comments...

PBIL Back to PBIL home page