(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE277

CP000124.PE277       Location/Qualifiers
FT   CDS_pept        complement(288875..289876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0284"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48669"
FT                   /db_xref="GOA:Q3JXK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK3"
FT                   /protein_id="ABA48669.1"
FT                   /translation="MKARSLDVVNSRLFDIAILSHDGRPVPTIGGLDVPATAALSDADA
FT                   HEVVIVPAQFMPDAQIGALERVFIDWLERRYAAGALVVGLNAAPLLAKAGLLDGRGATG
FT                   LPSERTLFARHFPAVRYTPSKPLVVDGRLITVSGINPAVDACAYVIDYCFGAGVSQRLL
FT                   RVALTQSLPSYEHMAVWAAQYKRHGDAPVLAVQDSVERALAHPPTLAELAARAAMSERT
FT                   LSRRFAAATGLTLRRYVAALRVELAAFLLRTSRMTLEHIADECGFASASALSHAFLAGQ
FT                   GCSPIQYRNRHRPDARPDARREPAGGGGTGGTGGTAAGSGEGAASSGGRAGK"
     atgaaggcgc gcagcctcga cgtcgtgaac agccggctgt tcgacatcgc gatcctgtcg        60
     cacgacgggc ggccagtgcc gacgatcggc ggtctcgacg tgccggcgac ggccgcgctg       120
     agcgacgccg acgcgcacga agtggtgatc gtgcccgcgc agttcatgcc ggacgcgcag       180
     atcggcgcgc tcgagcgcgt gttcatcgat tggctcgagc gccgctacgc ggcgggcgcg       240
     ctcgtcgtcg ggctcaacgc ggcgccgctc ctcgcgaagg ccggcctgct cgacggccgc       300
     ggcgcgaccg ggctgccgag cgagcgcacg ctgttcgcgc ggcattttcc ggcggtgcgc       360
     tacacgccgt cgaagccgct cgtcgtcgac gggcggctca tcacggtgag cgggatcaac       420
     ccggccgtcg acgcgtgcgc gtacgtgatc gattactgct tcggcgcggg cgtgtcgcag       480
     cggctgctgc gggtcgcgct cacgcaatcg ctgccgtcgt acgagcacat ggccgtgtgg       540
     gccgcgcagt acaagcggca cggcgacgcg ccggtgctcg cggtgcagga cagcgtcgag       600
     cgcgcgctcg cgcacccgcc gacgctcgcc gagctcgccg cgcgcgcggc gatgagtgag       660
     cgcacgctgt cgcgccgttt cgcggccgcg accgggctca cgctgcggcg ctacgtcgcc       720
     gcgctgcgcg tcgagctcgc cgcgttcctg ctgcgcacga gccggatgac gctcgagcac       780
     atcgccgacg aatgcggctt cgcgagcgcg agcgcgctga gccatgcgtt tctcgcgggg       840
     cagggatgca gcccgattca gtaccggaat cggcatcggc ccgatgcgcg gcccgacgcg       900
     cggcgcgagc cggcgggcgg cggcggcacg ggcggcacgg gcggcacggc ggcggggtcg       960
     ggcgaaggcg cggcgagctc ggggggacga gccgggaaat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page