(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE278

CP000124.PE278       Location/Qualifiers
FT   CDS_pept        289947..291239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0285"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49391"
FT                   /db_xref="GOA:Q3JXK2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK2"
FT                   /protein_id="ABA49391.1"
FT                   /translation="MATPGRPVPRSGFFITRKWRFGSTQIVPDLLKYRKQPAVGTDAPR
FT                   DSSPGDAMIPRTIFAEEHEQFRESVRRFIESEVMPHHERWEEQGYVDRDVWTKAAAAGY
FT                   HCASMPEAYGGVGADIRYSVVLFEEIARAGASGLGFGLHSEIVAPYILHYGSDALKARY
FT                   LPKLASAEMIGAIAMTEPGAGSDLQGVRTTAVRDGDHYVLNGSKIFITNGWHADVVIVV
FT                   ARTTPEGGSKGTSLFVVDTGMAGFSKGKRLKKVGMKAQDTSELFFDGVRVPAGNLLGEE
FT                   NRGFVYLMQELPWERLQIAISAIASAEAALAWTLDYTRERRAFGRAVIDFQTSRHALAE
FT                   LKSEIQIGRVFVDKCIELQLAGKLDAATASMAKYWTTDLQFKVIDRCVQLHGGYGYMWE
FT                   YPIARAWADSRVQQIYGGTNEIMKELIARTL"
     atggcgaccc cgggccggcc ggtgccgcgc agcggttttt tcataacaag aaaatggcgt        60
     ttcggatcaa cgcagattgt cccggacttg ctcaaatacc gcaaacagcc cgccgtcggc       120
     accgacgcgc cgcgcgattc atctcctgga gacgccatga ttccccgcac catcttcgcc       180
     gaagaacacg agcagttccg cgagtccgtc cgccgcttca tcgaatccga ggtgatgccg       240
     caccacgagc gctgggagga gcaaggctac gtcgatcgcg acgtgtggac gaaggcggcc       300
     gcggccggct atcactgcgc gagcatgccc gaggcgtacg gcggcgtggg cgcggacatc       360
     cgctacagcg tcgtgctgtt cgaggagatc gcgcgcgccg gcgcgtcggg gctcggcttc       420
     gggctgcatt cggagatcgt cgcgccgtac atcctccatt acggcagcga tgcgctcaag       480
     gcgcgctatc tgccgaagct cgcgagcgcc gagatgatcg gcgcgatcgc gatgaccgag       540
     cccggcgcgg gctcggacct gcaaggtgtg cgcacgaccg cggtgcgcga cggcgatcac       600
     tacgtgctca acggctcgaa gatcttcatc acgaacggct ggcatgcgga cgtcgtgatc       660
     gtcgtcgcgc gcacgacgcc cgagggcggc tcgaagggca cgagcctgtt cgtcgtcgac       720
     acgggcatgg cgggcttcag caagggcaag cggctgaaga aggtcggcat gaaggcgcag       780
     gacacgtcgg agctcttctt cgacggcgtg cgcgtgccgg ccggcaacct gctcggcgag       840
     gagaaccgcg gcttcgtcta tctgatgcag gagctgccgt gggagcggct gcagatcgcg       900
     atcagcgcga tcgcgtcggc cgaggcggcg ctcgcgtgga cgctcgacta cacgcgcgag       960
     cgccgcgcgt tcggccgcgc ggtgatcgat ttccagacga gccgccacgc gctcgccgag      1020
     ctgaagagcg agatccagat cggccgcgtg ttcgtcgaca aatgcatcga gctgcagctc      1080
     gcgggcaagc tcgacgcggc gacggcctcg atggcgaagt actggacgac cgatctgcag      1140
     ttcaaggtga tcgatcgctg cgtgcagctg cacggcggtt acggctacat gtgggaatac      1200
     ccgatcgcgc gcgcctgggc cgattcgcgc gtgcagcaga tctacggcgg caccaacgaa      1260
     atcatgaagg aactgatcgc gcgcacgctg tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page