(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE28

CP000124.PE28        Location/Qualifiers
FT   CDS_pept        38158..38373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48718"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA2"
FT                   /protein_id="ABA48718.1"
FT                   /translation="MFAAKRVRARHSRLPIKDAAHTHRRDKACHARATFDAGENRFAAT
FT                   NDITMHDAISFTRHSIRMPCAHRERV"
     atgtttgccg cgaaacgcgt gcgcgcgcgc cattcccgtt tgcccatcaa agacgccgcg        60
     cacacgcatc gccgtgacaa agcgtgccat gctcgagcga cgttcgacgc cggcgaaaat       120
     cggttcgccg ccacaaacga catcacgatg cacgacgcga tttcattcac ccgccattcg       180
     attcgcatgc catgcgcgca tcgcgaacgg gtgtag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page