(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE290

CP000124.PE290       Location/Qualifiers
FT   CDS_pept        305337..305600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0297"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49582"
FT                   /db_xref="GOA:Q3JXJ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXJ0"
FT                   /protein_id="ABA49582.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
     atgaagaagc gctttacgga acagcaaatc atcgggtttc tgaaggaagc cgaagccggt        60
     atgccggtca aggaactgtg caggaagcat gggttcagtg acgcgtcgtt ctacacctgg       120
     cgcgcgaagt tcggcggcat ggaagtctcg gaagcccgcc ggctcaagga cctcgaggtg       180
     gagaatgccc gactgaagaa actgctggcc gaagcaatgc tcgatatgga agcgttgaag       240
     gttgtcgtca agggaaagcc ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page