(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE302

CP000124.PE302       Location/Qualifiers
FT   CDS_pept        complement(319699..322566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0309"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49691"
FT                   /db_xref="GOA:Q3JXH8"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH8"
FT                   /protein_id="ABA49691.1"
FT                   /translation="MSNAPMSEFERASVALGYVPADDRDTWRQAGMALKAEFGEEGFTL
FT                   WNEWSQGAQNYNARDARDVWKSFKGGKITINTLFHLAKQGGFDPRAHRAKPVDPAERER
FT                   QKAERAAREAAELVELIEKQQAASALAESIWSAAEPAPAGHPYLVRKRIPADALRVYRG
FT                   NLSIGTAACDSALVIPARDADGTLRTLEFILTDGQKRYLPNGRKAGCFSLIGDAVSSVL
FT                   LIGEGYATCATLAAATGYPVAVAFDTGNLHAVATALRGQYPDARIVVCADDDHTTNGNP
FT                   GVTKARAAADAVGGAVTVPDFGPNRPAAGTDFNDLAAHLGPDAVVVAVRAALTSAGSSD
FT                   ADRGKARSPVEKPAKRPKTARAQDGKSRFVVDDKGVWFHGFNNQGDPLPPHWVSTRIDV
FT                   IAETRNEMNSEWGYLLEFTDRDGILKRWAVPAGLFAGDGTELRRMLLDMGVKLGVTQIA
FT                   RTQIANYVQMAQPDERVRCVPRVGWHHGAFVLPDRVIGTGKEALIYQADTPIQSQFKER
FT                   GTLDDWQREVAAYCVGNSRLLFCVATAFAGPLLHFSGLQSGGFHLLGTTSKGKSTGGVI
FT                   AASVFGSPDYVRSWKATDNALEAVATQHSDALLILDEIGQVEPRLVGDVIYMLANESGK
FT                   ARASRSGSAKPVLTWRLLFLSNGEKSVSALMAEGNKPMKGGIEVRLPAIPAEVGEMGVV
FT                   EKLHGFPTPAALIEHLERHAGIHYGTAGPAFIEWASSQAGELAEHLRIRVDELVGQWVP
FT                   DGSHSQVARVAKRFCLVAVAGELATAHGLTGWPQGEAVEAARRCFEGWLELRGGTGNSD
FT                   EAEAVRQVQHFLAAHGDNRFVWMNRAQDDHRPNVPHRAGFKQHVKRDERRTPIASDREY
FT                   YAEFGGKMSADDAESVETEYLIEAAVFRKDVCAGFDHKIVAKALMKRGVLMPRSDGYPY
FT                   RHEYIPGHGKFMVYRVLPSIFTLEL"
     atgagtaacg cacccatgtc cgaattcgag cgggcaagtg tcgcgctcgg ctatgttccg        60
     gccgacgacc gagacacgtg gcgtcaggcc ggcatggcgc tcaaggccga gttcggcgaa       120
     gagggtttca ccctctggaa cgaatggagc caaggcgcgc aaaactacaa cgcaagagac       180
     gcccgcgatg tatggaagtc gttcaagggc ggcaagatca ccatcaacac gctgtttcat       240
     ctcgccaaac aaggcggctt cgatccgcgc gcgcatcgag cgaagccggt cgatccagcg       300
     gagcgcgagc ggcagaaggc cgagcgcgcg gcccgcgaag cggccgagct ggtcgagctg       360
     atcgagaaac agcaagccgc atcggcgctc gctgaatcga tctggtcggc ggccgagccc       420
     gcgccggccg gtcacccgta tctcgttcgc aagcgcatcc cggccgatgc gctgcgcgtc       480
     tatcgtggca acctgagcat cggcacggcc gcgtgcgaca gcgcactcgt cattcctgca       540
     cgggacgcgg acggcacgtt gcggacgctc gaattcatcc tgaccgacgg gcagaaacgc       600
     tatctgccga atggccgcaa ggcgggctgt ttctcgttga tcggcgacgc ggtgtcgtcc       660
     gtcctgctga tcggcgaggg gtatgcgacc tgcgcgacgc tcgcggcggc gacaggctat       720
     ccggtcgccg tcgcattcga caccggcaac ctgcacgccg tcgcgacggc gctgcgcggc       780
     cagtatccgg acgcgcgcat cgtcgtgtgc gccgacgacg accacacgac gaacggcaat       840
     ccgggcgtca cgaaggcgcg cgcggcagcc gacgcggtag gcggcgcggt gaccgttccc       900
     gacttcggcc cgaaccgccc ggcagccggt acggacttca acgacttggc cgcccacctc       960
     ggcccggatg cggtggtcgt cgccgtgcgc gcggcgctca cttcggccgg ctcgtcggac      1020
     gccgacaggg gcaaggctag gtcgccagtc gagaagcccg ccaagcgccc gaaaacggcc      1080
     cgcgcgcagg acggcaagtc gcggttcgtc gtcgacgaca agggtgtgtg gtttcacggc      1140
     ttcaacaatc agggcgatcc gctcccgccg cattgggtca gcacgcgtat cgacgtgatc      1200
     gcggagacgc gaaacgagat gaacagcgag tggggctacc tgctcgaatt cacggaccgc      1260
     gacggcatcc tgaaacggtg ggcagtgccg gccggcctat ttgccggcga cggcacggag      1320
     ctgcgccgca tgctgctcga tatgggcgtg aagctcggcg tgacgcagat cgcccgcacg      1380
     cagatcgcga actatgtgca gatggcgcag ccggacgagc gcgtgcgctg cgtgccgcgc      1440
     gtcggctggc atcacggcgc gttcgtgctg cccgatcgcg tcatcggcac cggcaaagag      1500
     gcgctgatct atcaggccga tacgccgatc cagagccagt tcaaggagcg cggcacgctg      1560
     gacgactggc aacgcgaggt cgcggcctac tgcgtcggca atagccggct gctgttctgc      1620
     gtcgctaccg ccttcgctgg tccgttgctg catttctccg ggcttcagtc gggcgggttt      1680
     cacctgctcg gcacgacgtc caagggcaag tcgacgggcg gcgtcatcgc cgcgtccgtg      1740
     ttcggctcgc cggactacgt gcggagctgg aaggcgaccg acaacgcgct cgaagcggtc      1800
     gccacgcagc atagcgacgc gctgctgatc ctcgatgaaa tcgggcaggt ggagccgcgc      1860
     ttggtcggcg atgtgattta catgctcgcg aacgagtcgg gcaaggctcg tgcgtcgcgt      1920
     agcggctcgg cgaagccggt tctcacgtgg cggctgctgt tcctgtcgaa cggcgaaaag      1980
     agcgtgtccg cgctgatggc cgagggcaac aagcccatga aaggcggtat cgaggtgcgc      2040
     ttgcccgcga tcccggccga ggtgggcgaa atgggcgtcg tggaaaagct gcacggtttc      2100
     ccgacgccgg ccgcgctgat cgagcatctt gagcggcacg ccggcattca ctacggcacg      2160
     gccggccccg ctttcattga gtgggcgtcg tcgcaggccg gcgagctggc cgagcatctg      2220
     cgcatccgcg tcgatgagct ggtcgggcaa tgggtgccgg acggttcgca ttcgcaggtc      2280
     gcgcgtgtcg ccaagcggtt ctgcctcgtt gcggtggccg gcgagctggc gacggcgcac      2340
     gggctgaccg gctggccgca gggcgaagcg gtcgaggctg cgcgtcgctg cttcgaaggc      2400
     tggctcgaac tgcgcggcgg tacgggcaac tcggacgagg ccgaagccgt gcggcaggta      2460
     cagcatttcc tcgccgcaca cggcgacaac cgtttcgtgt ggatgaaccg ggcgcaggac      2520
     gaccatcggc cgaatgtgcc gcatcgagcg ggcttcaagc agcacgtgaa gcgcgacgag      2580
     cggcgcacgc ccatcgcctc cgatcgcgag tattacgccg agttcggcgg caagatgagc      2640
     gccgacgatg ccgaaagcgt cgagacggaa tacctgatcg aagcggccgt gtttcgcaag      2700
     gatgtgtgcg ccggcttcga ccacaagatc gtcgccaagg cactgatgaa gcggggcgtg      2760
     ctgatgccgc gtagcgacgg ctatccgtac cggcacgagt acatccccgg ccacgggaaa      2820
     ttcatggtct atcgcgtgtt gccgtcgatc ttcacgcttg agctgtga                   2868
//

If you have problems or comments...

PBIL Back to PBIL home page