(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE304

CP000124.PE304       Location/Qualifiers
FT   CDS_pept        complement(323823..324302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH6"
FT                   /protein_id="ABA47650.1"
FT                   /translation="MTVNLTQARECMSTQPSVNARRAWLDACAAFEDARVTCGNPDLLR
FT                   MAAFLERVATALWASDSRACHLAAIHATQIARLLVAPGTLSPASRIVLASELEGASLDL
FT                   GEALDDASRPLADPTVQQIDAITGVLWSSGNDECARAAVRLQRIAVMLVESGLSA"
     atgacggtca acttgacgca ggcgcgcgag tgcatgtcga cgcagccgtc cgttaatgcg        60
     cgccgcgcgt ggctcgacgc ttgcgcggcg ttcgaagacg cgcgcgtgac gtgcggcaat       120
     cccgatctgc ttcgcatggc cgcgttcctg gagcgcgtgg cgaccgccct ctgggcgtcg       180
     gatagccgcg cctgccatct ggcggcgatt cacgcgacgc aaattgcccg gctgctcgtc       240
     gcgccgggca ctctgtcgcc cgcgtcacgc attgtgctcg cgagcgagct ggaaggcgcg       300
     tcgctcgatt tgggcgaagc gttggacgat gccagccggc cgctcgccga tccgacggtt       360
     cagcagatcg acgcgatcac gggggtgctt tggtcgagtg gcaacgacga atgcgcccgc       420
     gccgccgttc gcctgcaacg catcgcagtc atgctggtcg aaagcgggct gagcgcatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page