(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE31

CP000124.PE31        Location/Qualifiers
FT   CDS_pept        40993..42399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0036"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50182"
FT                   /db_xref="GOA:Q3JY99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY99"
FT                   /protein_id="ABA50182.1"
FT                   /translation="MQKGHSETDLHRGLGQRQMRLIALGAAIGVGLFLGSANAIKMAGP
FT                   GIILSYIIGGAVIFVIMRALGEMAVHEPVAGSFSRYARNYLGPLAGYLTGWNYWFLWLV
FT                   TCIAEITAVGIYMGIWFPDVPRWIWALAALATMGSVNLLTVKAYGEFEFWFALIKVVTI
FT                   VVMIAVGIAMIAFGIGNHGVPMGISNLWAHGGFFPNGAQGVLMSMQMVMFAYLGVEMIG
FT                   LTAGEAANPQKTIPGAINSVFWRILLFYGGALFVILSIYPWNEIGTQGSPFVMTFERLG
FT                   IKTAAGIINFVVLTAALSSCNGGIFSTGRMLYNLAQQGHAPRTFGETTASGVPRRAILV
FT                   SMAALLVGVLLNYLVPEKVFVWVTSISTFGAIWTWGVILVTQMKFRASLAPAEERALRF
FT                   RMPFWPYASWVALAFLVLVIGLMAYFPDTRIALYVGPAWLVLLVVLYFVLKLEPEGGKA
FT                   AGLERRYGRG"
     atgcagaaag gacattcgga aaccgaccta caccgagggc tggggcaacg gcagatgcgc        60
     ctgatcgcgc tcggcgcggc gatcggcgtc gggctctttc tcggctcggc caacgcgatc       120
     aagatggcgg gccccggcat catcctgtcg tacatcatcg gcggcgcggt gatcttcgtg       180
     atcatgcgcg cgctcggcga gatggccgtg cacgagccgg ttgccggctc gttcagccgc       240
     tacgcgcgca actacctcgg gccgctcgcc ggttacttga cgggctggaa ctactggttc       300
     ctctggctcg tcacctgcat cgccgagatc acggcggtcg gcatctacat gggcatctgg       360
     ttccctgacg tgccgcgctg gatctgggcg ctcgccgcgc tggcgacgat gggatcggtg       420
     aacctgctca ccgtgaaggc gtatggcgaa ttcgaattct ggttcgcgct gatcaaagtg       480
     gtgacgatcg tcgtgatgat cgcagtgggc atcgcgatga tcgcgttcgg catcggcaat       540
     catggcgtgc cgatgggcat ctcgaacctg tgggcgcacg gcggcttctt cccgaacggc       600
     gcgcaaggcg tgctgatgtc gatgcagatg gtgatgttcg cgtacctcgg cgtcgagatg       660
     atcgggctga cggcgggcga agcggcaaat ccgcaaaaga cgattccggg cgcgatcaac       720
     tcggtgttct ggcgcattct gctcttctac ggcggcgcgc tcttcgtgat tctgtcgatc       780
     tacccgtgga acgagatcgg cacgcagggc agcccgttcg tgatgacgtt cgagcggctc       840
     ggcatcaaaa cggcggcggg catcatcaac ttcgtcgtgc tgacggcggc gctttcgtca       900
     tgcaacggcg gcatcttcag cacggggcgg atgctgtaca acctcgcgca gcagggccat       960
     gcgccgcgca cgttcggcga gacgacggcg agcggcgtgc cgcgccgggc gattctggtt      1020
     tcgatggcgg cgctgctcgt gggcgtgctg ttgaactacc tggtgccgga gaaagtgttc      1080
     gtctgggtga cgtcgatctc gacattcggg gcgatctgga catggggtgt cattctcgtc      1140
     acgcagatga agtttcgcgc gagcctcgcg ccggcggaag agcgggcgct gcggttccgg      1200
     atgccgttct ggccgtacgc gtcctgggtc gcgctcgcgt ttctggtgct cgtgatcgga      1260
     ttgatggcct attttccgga tacgcggatc gcgctttatg tcgggccggc ctggctcgtg      1320
     ttgctcgtgg tgctgtattt cgtgttgaag ctcgagccgg agggtggcaa ggctgcgggg      1380
     ctggagcgca ggtacgggcg cggatga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page