(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE319

CP000124.PE319       Location/Qualifiers
FT   CDS_pept        complement(341336..342067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51012"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG1"
FT                   /protein_id="ABA51012.1"
FT                   /translation="MRADWLRLYASHAASDAARHVASRGRRFSPRKARRRTPARRPGAR
FT                   AAVAAHAAGHSTGDIAMEEAYARRALLLHLGSVLQILSRLEGAPDNQSIEALLAANGML
FT                   ADVPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGW
FT                   KAYAATLREVSPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRER
FT                   AAASVESATPAGAPVRRESYE"
     ttgcgtgcag attggctacg cttgtatgca tcgcacgccg cgagcgacgc ggcaagacat        60
     gtcgcatcgc gcgggcggcg tttcagcccc cgtaaggccc gccgcaggac acccgcccgc       120
     cgccccgggg cgcgggcggc cgttgccgcg catgcggccg gccactcgac cggagacatc       180
     gccatggaag aagcttacgc acggcgcgcg ctgctgctgc acctcggcag cgtgctgcaa       240
     atcctgagcc gcctcgaagg agcgcccgac aaccagtcga tcgaggcgct gctcgcggcc       300
     aacggcatgc tcgccgacgt gccgctcgtc gagtacgtcg tgcaggacat gaccgtgcgc       360
     gaattctcgg cccgcgcgct gcgcgcgttt tgcctgtggc cgcaactgct gctcgaggac       420
     ccactcgact gcgccgcgct cgcgctgccc gttcgcaagc atctgttcgc gggcaacgat       480
     gccggatgga aagcgtacgc ggcgacgctg cgcgaggtct cgcccggctt cgacaccgca       540
     cgctcgtatg ctgccgagcc gcacgaggcc gagttcgatc tcgcagacga gcgcgatgcc       600
     gaaaccggcg acgggcccgt cgagcgagac gacgaagccg atgacgacgg ccgcctgcgc       660
     gagcgagcgg ccgcgagcgt cgagagcgcg acgccggccg gcgcgcccgt tcgccgcgaa       720
     tcgtacgaat ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page