(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE326

CP000124.PE326       Location/Qualifiers
FT   CDS_pept        complement(346139..347962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF4"
FT                   /protein_id="ABA50731.1"
FT                   /translation="MEFRPIKESDLGSTYDIRFPVTENRILPHQIHLLERDRVLEQLRS
FT                   GFGVLAIEGDAAVGYCTATGSGGPGKRSWRTAPKHCHAGPRRLRERAALAVAAPMAARS
FT                   RPRGCVTCKAPSAERRSSSETSCASARTGRRALRPILGFRRASASRPSSLAPRAAEPSA
FT                   DNDGPRAQTDSPRGHARLFFADAIGNARARSRRPLTASSHAIRRALAQRPITLRPPIPE
FT                   HAPAAPPIRERIEIEFGRRDRLAVPIAFDDHLAVRARDERAAVKHDLARCAALDADPIA
FT                   RGNRHQVRGRMPALRVVPMRARIDRRIVRLAADRARVQQQLRARERHCPRALRKPLIPA
FT                   DPDADPPVCGIPYAKARVARREIVFLRVARAVRNVRLSIDAERAAVRVEDRDRVELRLA
FT                   GALEEAHRQHDAELARERREAHKPRMAFIRLREREMRGVLVDAEIRRLEQFLQQHDLRA
FT                   ARGRVAHESLGARQVCVDVPVASHLRDGNGRLSHCARLRIDAAWANTAPARRGRPSPRR
FT                   ARLRRADTGRTGADRRTARSSRRAPRARRASRSADTAGCSRPPAASRCAPRMRRPPLAA
FT                   MRAPCAGTRRAARACGRADRTRSHPAPPTRE"
     atggagttcc gcccgataaa ggaaagtgat ctcggcagca cgtacgacat ccggtttccc        60
     gtcaccgaga atcgcatcct cccgcatcag atccacctcc tcgagcgcga tcgcgtgctc       120
     gagcaattgc gcagcggctt cggcgtcctc gcaatcgaag gcgacgccgc ggtcggctac       180
     tgcacggcca cgggctcggg cggccccggc aaaaggtcgt ggcgaaccgc cccgaagcat       240
     tgccacgccg gcccgcgccg attgcgcgaa cgtgccgccc tcgcggtggc cgcaccgatg       300
     gcggcacgtt cgcgtccgcg cggctgcgtc acatgcaagg cgccaagcgc cgaacgccgt       360
     tcgtcatccg aaacatcgtg cgcgagcgca cgcaccggcc ggcgcgccct tcggccgatt       420
     ctcggctttc gccgcgcatc ggcaagccgg ccgtcgtcac tagcgcctcg cgctgccgag       480
     ccgtctgccg acaacgacgg cccccgagcg caaacggatt cgccgcgcgg acatgcgcgg       540
     ctttttttcg ccgacgcaat cggcaacgcg cgagcgcgct cccgccgccc gctcaccgcg       600
     tcatcgcacg cgatccgccg cgccctcgct caacgcccga taacactccg gccgccgatc       660
     ccggaacacg ccccagccgc gccgccgata cgcgagcgca tcgagatcga attcggccgt       720
     cgcgatcgcc tcgccgtgcc gatcgcattc gacgatcatc tcgccgtccg cgcccgcgat       780
     gaacgagctg ccgtaaaaca cgatctcgcc cgatgcgccg cgctcgacgc cgacccgatt       840
     gctcgcggca accggcatca ggttcgcggc cgcatgcccg cgctgcgcgt tgtgccaatg       900
     cgcgcgcgaa tcgatcgacg catcgtgcgg ctcgctgccg atcgcgctcg ggtacagcaa       960
     cagctccgcg cccgcgagcg ccattgcccg cgcgcactcc ggaaaccatt gatcccagca      1020
     gatcccgacg ccgatccgcc cgtatgcggt atcccatacg cgaaagcccg tgtcgcccgg      1080
     cgtgaaatag tatttctccg tgtagcccgg gccgtccgga atgtgcgtct ttcgatagat      1140
     gccgagcgcg cggccgtccg cgtcgaagat cgcgaccgag ttgaactgcg tctggccggc      1200
     gcgctcgaag aagctcaccg gcagcacgac gccgagctcg cgcgcgagcg acgcgaagcg      1260
     cataagccac ggatggcctt catacggctg cgcgagcgcg agatgcgcgg ggtgctggtc      1320
     gatgcagaaa tacggcgtct cgaacaattc ctgcagcagc acgatctgcg cgccgcgcgc      1380
     ggccgcgtcg cgcacgagtc gctcggcgcg cgacaggttt gcgtcgacgt tccagtcgca      1440
     agccatctgc gtgacggcaa cggtcgtctt tctcattgtg cgcgcctcag gatcgatgca      1500
     gcgtgggcca atacggcgcc agcgcggcgc gggcggcctt caccgcggcg cgctcgcctt      1560
     cgccgagcgg atactggacg aactggtgcg gatcgtcgaa cggcgcgttc cagccgacga      1620
     gcccctcgag cacgccgagc gtcgcgatcg gcagatacgg caggctgtag ccgccctcct      1680
     gcagcatcac gatgcgcccc ccgcatgcgc cgcccgccgc ttgccgcaat gcgcgcgcca      1740
     tgtgccggaa cccgtcgcgc tgcacgcgca tgcggccgag cggatcgaac gcgttcgcat      1800
     cctgccccgc cgacacgaga atga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page