(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE329

CP000124.PE329       Location/Qualifiers
FT   CDS_pept        complement(349526..349810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0336"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50060"
FT                   /db_xref="GOA:Q3JXF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF1"
FT                   /protein_id="ABA50060.1"
FT                   /translation="MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVF
FT                   RALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA"
     atgaagacga tcggccgcat attgctggcg ctggtgctta cctggcctct tctgacgggc        60
     atctcgtcat tgccgttgct gacgcattgg ttcgccaacg gcggcgaagg ctggaacgcg       120
     ctgtcgcccg tgtttcgcgc gctcggctct gacggcggcg aacaaaacga agagatcttc       180
     gtcggcatcc tgctcgtcat cagcttcgtt ctcgcgctcg ttctgtcgtt cgccctcttc       240
     ggcctggtcg accgcctccg gcattcgacc gatcgccgag cgtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page