(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE330

CP000124.PE330       Location/Qualifiers
FT   CDS_pept        complement(349807..350289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0337"
FT                   /product="unnamed protein product"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49280"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF0"
FT                   /protein_id="ABA49280.1"
FT                   /translation="MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVAD
FT                   KGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWLALYRIDGQIDDWTIVNGIR
FT                   RGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK"
     atgcccgccg agtgcacatt cgtcctgaac cgcagccgcc tatcgacgct gacctgtcca        60
     ggattcggaa gcgtccccgc cttttccggt aacggccgat acatcaacga tccgggctcg       120
     actgccgtag cggataaagg cccgctgccc gcaggcgtct actacatcat cgaccgacaa       180
     agcggcggcc atcttggctg gttccgggac acggtgatgg atgcagccct gaacacgtat       240
     cgcgcggaat ggctcgcgct gtaccgcatt gacggccaaa ttgacgactg gacgatcgtc       300
     aacggcatcc gccgcggcca tttccgtctg catccggtcg gccggctggg cgaaagcgac       360
     gggtgcatta cgctgacgag ccgtgggcag ttcgataagc tgcgggcttt cctgaaagcg       420
     caaccgacga cgcaggttcc gggaacctca ttcagggcat acgggaaggt gacggttaaa       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page