(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE340

CP000124.PE340       Location/Qualifiers
FT   CDS_pept        364784..365419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0348"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48968"
FT                   /db_xref="GOA:Q3JXE0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE0"
FT                   /protein_id="ABA48968.1"
FT                   /translation="MFGITHLGLFMAAVFLLNITPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHVLACAFGLTAVLAASATAFTVIKVVGAAYLVYLGVRLIFAKQEPAAERPA
FT                   RRGADKSLRQLFMQGFLTNVLNPKVVLFFVSFFPQFVSVDSNHKVLAFLTLGAVFLAMS
FT                   TVWSCTVAWVAGTVTRRFAGKPGVKKWLDRGVGSAFVGLGVKLATSTR"
     atgttcggca tcacccatct tggcttgttc atggcggcgg tctttctgct gaacatcacg        60
     ccggggcccg acaccgcgta catcgtcggc cgcagcgtcg cgcaggggcg cggcgccggc       120
     ctcatgtccg cgctcggcat ctcggccggc tgctgcgtgc acgtgctcgc atgcgctttc       180
     ggcctgacgg cggtgctcgc cgcgtcggcc accgcgttca cggtgatcaa ggtcgtcggc       240
     gcggcctatc tcgtctatct gggcgtgcgt ctcatcttcg ccaagcagga gccggcggcc       300
     gagcggcccg cgcggcgagg cgcggacaaa tcgctgcgcc agctgttcat gcaggggttc       360
     ctgaccaatg tgctgaaccc gaaggtggtg ctgttcttcg tgtcgttctt tcctcagttc       420
     gtatcggtcg acagcaacca caaggtgctc gcgttcctga cgctcggcgc ggtgttcctc       480
     gcgatgagca ccgtgtggtc gtgcaccgtg gcgtgggtcg cgggcaccgt cacgcgacgt       540
     tttgccggca agcctggtgt gaagaaatgg ctcgaccgcg gtgtcggcag cgcattcgtc       600
     ggcctgggcg tcaagctcgc gacgtcgacg cgctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page