(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE345

CP000124.PE345       Location/Qualifiers
FT   CDS_pept        371281..371964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0353"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50651"
FT                   /db_xref="GOA:Q3JXD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD5"
FT                   /protein_id="ABA50651.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVDVAENAQAARDYRLRQA
FT                   PDLVLLDIWMPDTDGVTLLKEWASQGQLTMPVIMMSGHATIDTAVEATKIGALDFLEKP
FT                   ITLQKLLKSVEHGLARGAAPLPASAAAKPAAGAAVASAAALPTLGDDPAVALAGQTTAA
FT                   IPFDIPLREARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVELGKKP
FT                   AEGAA"
     atggcaacca tcctggtggt agatgatgaa atgggcatcc gggaattgct ctcggagatc        60
     ctcagcgacg aagggcacgt cgtcgacgtc gcggaaaacg cgcaagccgc gcgcgactac       120
     cggctgcggc aggcgcccga tctcgtgctg ctcgacatct ggatgcccga caccgacggc       180
     gtcacgttgc tgaaggaatg ggcgagccaa ggacaactga cgatgcccgt catcatgatg       240
     tcggggcacg cgacgatcga caccgccgtc gaggcgacga agatcggcgc gctcgatttt       300
     ctcgagaagc cgatcacgct gcagaagctg ctgaagtcgg tcgagcacgg tctcgcgcgc       360
     ggcgcggcgc cgctgcccgc gagcgctgcg gcgaagcccg cggcgggggc tgcggtcgcg       420
     tcggcggccg cgctgccgac gctcggcgac gatccggccg tggcgctcgc gggccagacg       480
     acggccgcga tcccgttcga catcccgctg cgcgaggcgc gcgacgcgtt cgagcgcgcg       540
     tacttcgaat atcacctcgc gcgcgagaac ggcagcatga cgcgcgtcgc ggagaagacg       600
     ggcctcgagc gcacgcacct gtaccgcaag ctcaagcagc tcggcgtcga gctcggcaag       660
     aagccggccg aaggcgcggc ataa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page