(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE346

CP000124.PE346       Location/Qualifiers
FT   CDS_pept        complement(372418..373911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD4"
FT                   /protein_id="ABA49515.1"
FT                   /translation="MNEASGSGNVQVLVRLHRQPPPRMTLAPIDREPGVELARRAVHRL
FT                   HEEMLEVELRVIGKALVVLRHHHLQFVALRDDERRIRLRAHADPVDRFEHGQRAVRLDR
FT                   DREARRVQRVDERLIELQHRLAARADDEAIRLARRPERRDPRRERSGILELAAVLAVGA
FT                   DEVGIAEAAHRAVAVRFAPRPEVAAGEPAEHGRTAGVRALALQRIENFLDRVRHAASFR
FT                   LAPLAFRCSMNLVAARATRVRRASRASGGRLRHAFAAQIGVIAALAQLACRAFATAEAP
FT                   VMQLRALADIARVRLDADQLDERRAAQLLGEPPRIGLVEPHQRRFQHEARVHAEIERDL
FT                   QRLHRVVAAVRIAGEIGLAHAADERAQPAPISDRRGDRHEQQVAARHERVRQAVRRRLD
FT                   LDRARHRGIADRAEHRQIDQVIVAQLVRPLRKTPLQRIAHALATFELDAVALAVIEAER
FT                   LDGLIALERPGHTCGRILAAGKQYERAVLSVCPNHRDTP"
     atgaatgaag cgtcaggctc agggaatgtt caggtacttg tgcgtctgca tcgacagccg        60
     ccaccgcgga tgacgcttgc accaatcgat cgcgagccgg gtgttgagct cgcgcgacgg       120
     gccgtccatc ggctgcacga ggaaatgctc gaagtcgagc ttcgcgtaat cggcaaggcg       180
     ctggttgtcc tgcggcacca ccaccttcag ttcgttgccc ttcgtgacga cgagcggcgc       240
     atccgccttc gggctcacgc agatccagtc gatcgattcg agcacgggca gcgagccgtt       300
     cgtctcgatc gcgatcgtga agcccgccgc gtgcagcgcg tcgacgagcg gctgatcgag       360
     ctgcagcatc ggctcgccgc ccgtgcagac gacgaagcga tacgcctcgc ccgccggcca       420
     gagcgacgcg atcctcgccg cgagcgaagc ggcatccttg aacttgccgc cgttctcgcc       480
     gtcggtgccg acgaagtcgg tatcgcagaa gcggcacacc gcgccgtcgc ggtccgcttc       540
     gcgccccgtc cagaggttgc agccggcgaa ccggcagaac acggccggac ggccggcgtt       600
     cgcgccctcg ccctgcaacg tatagaaaat ttccttgacc gtgtacgtca tgctgcttcg       660
     ttccggctcg cgccgctcgc tttccgttgt tcgatgaatc tcgttgccgc ccgcgccacg       720
     cgcgtgcgcc gtgccagccg cgcgtcaggc gggcgcctcc gtcacgcttt cgccgcgcag       780
     ataggcgtca tagccgcgct tgcgcagctt gcatgccggg cattcgccac agccgaagcc       840
     ccagtcatgc agctccgagc gctcgccgac atagcacgtg tgcgtctcga cgcggatcag       900
     ctcgacgagc ggcgcgccgc ccagttgctc ggcgagccgc cacgtatcgg ccttgtcgag       960
     ccacatcagc ggcgtttcca gcacgaagcg cgtgtccatg ccgagattga gcgcgacctg      1020
     cagcgccttc atcgtgtcgt cgcggcagtc cggatagccg gagaaatcgg tctcgcacat      1080
     gccgccgacg agcgcgcgca gcccgcgccg ataagcgatc gccgcggcga tcgtcatgaa      1140
     cagcaggttg cggcccggca cgaacgtgtt cggcaggccg ttcgacgccg tctcgatctc      1200
     gatcgcgcgc gtcatcgcgg tatcgctgat cgagccgagc accgacagat cgatcaggtg      1260
     atcgtcgccc agcttgtgcg accactgcgg aaaacgccgc ttcagcgcat cgcgcacgcc      1320
     ctcgcgacat tcgagctcga cgcggtggcg ctggccgtaa tcgaagccga gcgtctcgac      1380
     ggtctgatag cgctcgagcg cccaggccac acatgtggcc gaatcctggc cgccggaaaa      1440
     caatacgagc gcgccgtcct tagcgtctgt ccgaatcacc gtgatactcc gtga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page