(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE347

CP000124.PE347       Location/Qualifiers
FT   CDS_pept        372433..373167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0355"
FT                   /product="exsB protein"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48970"
FT                   /db_xref="GOA:Q3JXD3"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXD3"
FT                   /protein_id="ABA48970.1"
FT                   /translation="MIRTDAKDGALVLFSGGQDSATCVAWALERYQTVETLGFDYGQRH
FT                   RVELECREGVRDALKRRFPQWSHKLGDDHLIDLSVLGSISDTAMTRAIEIETASNGLPN
FT                   TFVPGRNLLFMTIAAAIAYRRGLRALVGGMCETDFSGYPDCRDDTMKALQVALNLGMDT
FT                   RFVLETPLMWLDKADTWRLAEQLGGAPLVELIRVETHTCYVGERSELHDWGFGCGECPA
FT                   CKLRKRGYDAYLRGESVTEAPA"
     gtgattcgga cagacgctaa ggacggcgcg ctcgtattgt tttccggcgg ccaggattcg        60
     gccacatgtg tggcctgggc gctcgagcgc tatcagaccg tcgagacgct cggcttcgat       120
     tacggccagc gccaccgcgt cgagctcgaa tgtcgcgagg gcgtgcgcga tgcgctgaag       180
     cggcgttttc cgcagtggtc gcacaagctg ggcgacgatc acctgatcga tctgtcggtg       240
     ctcggctcga tcagcgatac cgcgatgacg cgcgcgatcg agatcgagac ggcgtcgaac       300
     ggcctgccga acacgttcgt gccgggccgc aacctgctgt tcatgacgat cgccgcggcg       360
     atcgcttatc ggcgcgggct gcgcgcgctc gtcggcggca tgtgcgagac cgatttctcc       420
     ggctatccgg actgccgcga cgacacgatg aaggcgctgc aggtcgcgct caatctcggc       480
     atggacacgc gcttcgtgct ggaaacgccg ctgatgtggc tcgacaaggc cgatacgtgg       540
     cggctcgccg agcaactggg cggcgcgccg ctcgtcgagc tgatccgcgt cgagacgcac       600
     acgtgctatg tcggcgagcg ctcggagctg catgactggg gcttcggctg tggcgaatgc       660
     ccggcatgca agctgcgcaa gcgcggctat gacgcctatc tgcgcggcga aagcgtgacg       720
     gaggcgcccg cctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page