(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE351

CP000124.PE351       Location/Qualifiers
FT   CDS_pept        complement(375211..376347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49777"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC9"
FT                   /protein_id="ABA49777.1"
FT                   /translation="MSVRRPGRLRRRRAARPRLLRGRELAILERRRVVALRGGGRIVRA
FT                   GDVEIAHDAVAAALVERRGHVLRNRLARVGRALVPGKRLPVVARRTAPVEKLVRERELG
FT                   LHVPLLRGLQEPVVRGRRIARDEFAVVEHPAVHVLRLRHPRIGRAPQPAQSFRHVRRHA
FT                   LTVDQHHRVIERGETVAARRRIVKLHERRAQIARVVVGHRHFGLALRVEPARRARRLRE
FT                   RAARRRTERRRGERTDYRAAQHTRRARGERRAAAFPAHPRTSCSACRVARSSHTTSADN
FT                   ATTRNPASRDWRAPAVSAAKMPTGTPARRPAASTCSSAAATSGCFVSPRCPRLADRSAG
FT                   PTNTQSTPGVAAIRSASSTPRADSICTIVAICAFAVCT"
     gtgtcagtac gacggcccgg tcgccttcgg cgccgacgcg ccgcccggcc ccgccttctg        60
     cgcggccgtg agctcgcgat acttgagcgc cgccgcgtcg tcgccctgcg cggcggcggc       120
     cgcatagtac gcgcgggcga tgtcgagatt gcgcacgacg ccgtcgccgc cgcgctcgta       180
     gaacgacgcg gtcacgtatt gcgaaaccgg ctcgcccgcg tcggccgcgc gcttgtacca       240
     ggcaaacgcc tgccggttgt cgcgcggcgt accgcgcccg tcgagaaact ggttcgcgag       300
     cgcgagctcg gcctgcacgt gcccttgctg cgcggccttc aggaaccagt cgtgcgcggc       360
     cgccggatcg cgcgcgacga attcgccgtc gtcgagcatc cggccgtaca cgtactgcgc       420
     ctgcgtcatc cccgcatcgg ccgcgcgccg cagccagcgc aatccttccg gcacgttcgc       480
     cgtcacgccc tcaccgttga tcagcatcat cgcgtaatcg aacgcggcga gacggttgcc       540
     gcgcgccgcc gcatcgtgaa actgcacgag cgccgcgcgc agattgcccg cgttgtagtc       600
     ggccaccgcc acttcggtct cgcgctgcgg gtcgagccgg ctcggcgcgc ccggcgcctg       660
     cgcgagcgcg ccgcccgccg ccgcaccgag cgccgccgcg gcgagcgaac cgattaccgc       720
     gccgcgcagc acacgcggcg tgcgcgtgga gagcggcgcg ccgcggcgtt tcccgctcat       780
     ccccgcacct cctgcagcgc ctgtcgcgtc gcgcgcagca gccacacgac gtccgcggac       840
     aacgcgacca cgcggaatcc ggcttcgaga gactggcgcg cgccggccgt atccgcggcg       900
     aagatgccga ccggcacgcc ggcgcgccgc ccggccgcga gcacgtgctc gagcgcggcc       960
     gcgacgtccg gatgcttcgt gtcaccgaga tgcccgaggc tcgcggacag gtcggcgggc      1020
     ccgacgaata cgcaatcgac gcccggcgtc gccgcgatcc gctcggcttc gtcgacgccg      1080
     cgcgccgatt cgatctgcac gatcgtcgcg atctgcgcgt tcgccgtctg cacgtag         1137
//

If you have problems or comments...

PBIL Back to PBIL home page