(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE352

CP000124.PE352       Location/Qualifiers
FT   CDS_pept        375568..376344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0361"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49832"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC8"
FT                   /protein_id="ABA49832.1"
FT                   /translation="MSGKRRGAPLSTRTPRVLRGAVIGSLAAAALGAAAGGALAQAPGA
FT                   PSRLDPQRETEVAVADYNAGNLRAALVQFHDAAARGNRLAAFDYAMMLINGEGVTANVP
FT                   EGLRWLRRAADAGMTQAQYVYGRMLDDGEFVARDPAAAHDWFLKAAQQGHVQAELALAN
FT                   QFLDGRGTPRDNRQAFAWYKRAADAGEPVSQYVTASFYERGGDGVVRNLDIARAYYAAA
FT                   AAQGDDAAALKYRELTAAQKAGPGGASAPKATGPSY"
     atgagcggga aacgccgcgg cgcgccgctc tccacgcgca cgccgcgtgt gctgcgcggc        60
     gcggtaatcg gttcgctcgc cgcggcggcg ctcggtgcgg cggcgggcgg cgcgctcgcg       120
     caggcgccgg gcgcgccgag ccggctcgac ccgcagcgcg agaccgaagt ggcggtggcc       180
     gactacaacg cgggcaatct gcgcgcggcg ctcgtgcagt ttcacgatgc ggcggcgcgc       240
     ggcaaccgtc tcgccgcgtt cgattacgcg atgatgctga tcaacggtga gggcgtgacg       300
     gcgaacgtgc cggaaggatt gcgctggctg cggcgcgcgg ccgatgcggg gatgacgcag       360
     gcgcagtacg tgtacggccg gatgctcgac gacggcgaat tcgtcgcgcg cgatccggcg       420
     gccgcgcacg actggttcct gaaggccgcg cagcaagggc acgtgcaggc cgagctcgcg       480
     ctcgcgaacc agtttctcga cgggcgcggt acgccgcgcg acaaccggca ggcgtttgcc       540
     tggtacaagc gcgcggccga cgcgggcgag ccggtttcgc aatacgtgac cgcgtcgttc       600
     tacgagcgcg gcggcgacgg cgtcgtgcgc aatctcgaca tcgcccgcgc gtactatgcg       660
     gccgccgccg cgcagggcga cgacgcggcg gcgctcaagt atcgcgagct cacggccgcg       720
     cagaaggcgg ggccgggcgg cgcgtcggcg ccgaaggcga ccgggccgtc gtactga          777
//

If you have problems or comments...

PBIL Back to PBIL home page