(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE365

CP000124.PE365       Location/Qualifiers
FT   CDS_pept        complement(391525..392577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0374"
FT                   /product="peptidase, M48 family family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47864"
FT                   /db_xref="GOA:Q3JXB5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB5"
FT                   /protein_id="ABA47864.1"
FT                   /translation="MQAKLRVARAALTFVGGVALGVAGPVLGFELCMAEPMLVADNGAP
FT                   PVPSAPAVATPAAPAAAPAAGNPQPYALGDQQVRYGNAIVFRSLIPSPLLEQLTDNEYR
FT                   QTVQDAAQRKRLLPPNNARVKRLRTIVMRLAPYAVKWSERVKGWNWEIEVLRSRSIRAF
FT                   CLPGGKVLVDSGLLERLRLTDDELGVLFAHEIAHALREHARSSLGEQQAASLGTGATPL
FT                   PPLFGLSEPLPAPLGVVERFASVRYDPTDETEADVIGGDIAARAGFDPRAAITLWDKLA
FT                   VATRADKDNGFIHAHPYDTRRRNDLRKRLADLMPLYRKALVKNADARANAAGAGAAAGA
FT                   KQRGAAAANR"
     gtgcaggcta agctgcgcgt cgcccgcgcc gcgctcacgt tcgtgggcgg cgtcgcgctc        60
     ggcgtcgcgg gcccggtgct cgggttcgag ctgtgcatgg ccgagccgat gctcgtcgcc       120
     gacaacggcg cgccgccggt gccgagcgcg cccgccgtcg ccactccggc ggcgccggcc       180
     gcggcccccg ccgccggcaa tccgcagccg tacgcgctcg gcgatcagca ggtgcgctac       240
     ggcaacgcga tcgtgttccg cagcctgatt ccgtcgccgc tcctcgaaca gctgaccgac       300
     aacgaatacc ggcagaccgt gcaggacgcc gcgcagcgca agcgcctgct gccgccgaac       360
     aacgcgcgcg tgaagcggct gcgcacgatc gtcatgcggc tcgcgccgta tgcggtcaag       420
     tggagcgagc gcgtgaaggg ctggaactgg gaaatcgagg tgctgcgctc gcgttcgatc       480
     cgcgcgttct gcctgccggg cggcaaggtg ctcgtcgaca gcgggctgct cgagcggctg       540
     cgcctcaccg acgacgagct cggcgtgctg ttcgcgcacg agatcgcgca cgcgctgcgc       600
     gagcacgcgc gctcgagcct cggcgagcag caggccgcgt cgctcggcac cggcgcgacg       660
     ccgctgccgc cgctcttcgg gctgtcggag ccgctgcccg cgccgcttgg cgtcgtcgag       720
     cgcttcgcgt cggtccgcta cgatccgacc gacgaaaccg aggccgacgt gatcggcggc       780
     gacatcgccg cgcgcgccgg cttcgatccg cgcgcggcga tcacgctgtg ggacaagctc       840
     gcggtcgcga cacgcgccga caaggacaac ggtttcatcc atgcgcatcc gtacgacacg       900
     cggcgccgca acgatctgcg caagcgcctc gccgacctga tgccgctcta tcggaaggcg       960
     ctcgtcaaaa acgccgacgc gcgcgcgaac gccgcgggcg cgggcgccgc ggccggcgcg      1020
     aagcagcgcg gcgccgcggc ggcgaatcgg taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page