(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE37

CP000124.PE37        Location/Qualifiers
FT   CDS_pept        complement(46058..46693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0043"
FT                   /product="rare lipoprotein A family protein"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49285"
FT                   /db_xref="GOA:Q3JY93"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY93"
FT                   /protein_id="ABA49285.1"
FT                   /translation="MKFRLPRHLGTLAVFFALTGCAVPPNAPTSEQAKSAASKDALRTA
FT                   ASGAASNNKESAGAPLNFDTALASMPAAGSQDVSRQSLADAKPIDAADISDFRQTGRAS
FT                   WYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGPFSRG
FT                   RILDLSYAAAKVIGLVHAGTARVKIQGLSPEEARVARDEMLASNSTTK"
     atgaaatttc gattaccgag gcatctcggg actctagctg tatttttcgc gctgacaggc        60
     tgcgcggtgc cgccgaacgc accgacctcc gagcaggcga aaagcgccgc gtcgaaggat       120
     gcgctgcgca cggccgcatc gggcgcggcc agcaacaata aggaatcggc gggcgcgccg       180
     ctgaacttcg acacggcgct cgcctcgatg ccggccgccg gctcgcagga cgtctcgcgc       240
     caatcgctcg cggacgcgaa gccgatcgat gccgcggaca tctcggattt ccggcagacc       300
     ggccgcgcgt catggtacgg caagggtttt cacggccgcc gcaccgcgaa cggcgaacgc       360
     ttcaacatga acgaattcac cgccgcacac cggacgctgc cgctcgcgtc atacgtgcgc       420
     gtgacgaacc aggcgaacgg caagtccgtc gtcgtgaaga tcaatgatcg cggtccgttc       480
     tcgcgcgggc ggatcctcga tctgtcgtat gcggccgcga aggtgatcgg cctggtccat       540
     gcgggtaccg cgcgcgtgaa gatccagggg ctctcgcctg aagaggcgcg cgtcgcgcgc       600
     gacgagatgc tcgcgtcgaa cagcacgacg aagtaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page