(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE375

CP000124.PE375       Location/Qualifiers
FT   CDS_pept        400249..400791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0384"
FT                   /product="response regulator protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49423"
FT                   /db_xref="GOA:Q3JXA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="PDB:3RQI"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA5"
FT                   /protein_id="ABA49423.1"
FT                   /translation="MSDKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGA
FT                   EKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVESILAALQTNASEVQAEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALN
FT                   MHRRTLQRKLAKKPVRQ"
     atgagcgaca agaatttcct cgtgatcgac gacaacgaag tgtttgccgg cacgctggcg        60
     cgcgggctcg agcgccgcgg ctacgcggtg cggcaggcgc acaacaagga cgaggcgctc       120
     aagctcgcgg gcgccgagaa gttcgagttc atcaccgtcg atctgcacct cggcaacgat       180
     tcgggcctga gcctcatcgc gccgctgtgc gatctgcagc ctgacgcgcg gatcctcgtg       240
     ctgaccggct acgcgagcat cgcgaccgcg gtgcaggcgg tgaaggacgg cgcggacaac       300
     tacctcgcga agccggcgaa cgttgaatcg atcctcgccg cgctgcagac gaacgcgagc       360
     gaggtgcagg ccgaagaggc gctcgagaac ccggtggtgc tgtcggtcga ccggctcgaa       420
     tgggagcaca tccagcgcgt gctcgcggag aacaacaaca acatctcggc gaccgcgcgc       480
     gcgctgaaca tgcatcgccg cacgctgcag cgcaagctcg cgaagaagcc ggtgcggcag       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page