(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE382

CP000124.PE382       Location/Qualifiers
FT   CDS_pept        405636..407339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48730"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX98"
FT                   /protein_id="ABA48730.1"
FT                   /translation="MIDARAEPLEDARVDLRVGRRARDDLLEQVHVDRAGARVREQQAA
FT                   RAQQLQAAQVDVLVRARRAIDAVARRRELRRIEHDQVEALAFVDEAAQRLERVGVEPLR
FT                   ARGVEAVRGDVALRERERVARRIDRHDPLRAALERREREAARVAEAVQHVAIARVLRDE
FT                   RAVLALVDVEARLVAVAHVDVIQHAVLVRDQRVGRRVAREHAGRLFEPFLFADRHVRAL
FT                   VDVRAAGGRDERRDDRALPVLDARRHELADELAATLAVARRDRRGRAAFGRARGGVAGV
FT                   GGASRRDVVIDDEPRQPVRLAEHEPHRVRARDHRAAMRERALHAPLEERVVDRLVLVEA
FT                   PHAQPDLRMRAVRGAREEAPVVRAHDDGRAGRGLAVDAVDRVRVDPRVAAQQGFVFRRL
FT                   ERNGMHVGIEMAARGAAECDSGIRRFSDAARAAARVSRAFSRADARCRKSSRDAGSRAT
FT                   YRPASPRCSRARAAPAPRAGRRSIAARASRTSGAVRADERSPECPPRAPRASRARARRR
FT                   ATSGCRAPRGRAVADRASRIRRAPRARRAARRAPCGRRAPCAPCRPCRAR"
     atgatcgacg cccgcgccga gccgcttgag gatgcgcgcg tcgaccttcg cgtcggccgc        60
     cgcgcccgcg acgatcttct ggaacaggtc catgtcgatc gcgccggagc acgagtacgt       120
     gaacagcagg ccgcccgggc gcagcagctt caagccgctc aggttgatgt ccttgtacgc       180
     gcgcgccgcg cgatcgacgc tgtcgcgcgt cggcgcgaac ttcggcggat cgagcacgat       240
     caggtcgaag cgctcgcctt cgtcgacgag gcggcgcagc gtcttgaacg cgtcggcgtc       300
     gagccattgc gcgcgcgcgg cgtcgaagcc gttcgcggcg acgttgcgct gcgcgagcgc       360
     gagcgcgtcg cccgacgaat cgatcgacac gacccgcttc gcgccgccct tgagcgccgc       420
     gagcgagaag ccgcccgtgt agcagaagca gttcagcacg tcgcgatcgc gcgcgtactg       480
     cgcgacgagc gcgcggttct cgcgctggtc gacgtagaag cccgtcttgt ggccgttgcg       540
     cacgtcgacg tgatacagca cgccgttctc gttcgcgatc agcgtgtcgg gcggcgcgtc       600
     gcccgcgagc acgccggtcg tctgttcgag cccttccttt tcgcggatcg acacgtccga       660
     gcgctcgtag acgttcgggc agccggtggc cgcgacgagc gccgcgacga tcgcgccctt       720
     ccagtgctcg acgcccgccg ccatgaactg gcagacgagc tggccgcgac cctcgccgtc       780
     gcccggcgcg accggcgcgg ccgcgccgcc ttcggccgcg cgcgcggcgg cgtcgccggt       840
     gtgggcggcg cctcgcgccg cgacgtagta atcgacgatg agccccggca acccgtccgc       900
     ctcgccgaac acgagccgca ccgcgtccgt gcccgagatc atcgcgcggc gatgcgcgag       960
     cgcgcgttgc acgcgccgct tgaagaacgc gtggtcgatc ggctcgttct cgtcgaagct      1020
     ccacacgcgc agccggatct gcgaatgcgg gctgtacgcg gcgcgcgcga ggaagcgccc      1080
     gtcgtgcgcg cgcacgatga cggtcgcgcc gggcgcgggc ttgccgtcga cgcggtcgat      1140
     cgcgttcgcg tagacccacg ggtggcggcg cagcagggat ttgtctttcg acggcttgag      1200
     cgtaacggta tgcatgtcgg gatcgaaatg gccgcgcggg gcgcggcgga gtgtgattct      1260
     gggattcgtc gattcagtga tgcggcgcgc gcggcggcgc gggtcagtcg cgctttttcg      1320
     cgcgcggatg cgcgctgtcg taaatcttcg cgagatgctg gaagtcgagc gacgtataga      1380
     cctgcgtcgc cgagatgctc gcgtgcccga gcagctcctg caccgcgcgc aggtcgccgc      1440
     tcgattgcag cacgtgcgtc gcgaacgagt ggcgcagtac gtgcggatga acgttcgccg      1500
     gaatgcccgc cgcgagcgcc gcgcgcttca cgcgctcgcg cacgacgccg ggcgacatcc      1560
     ggttgccgcg caccgagagg aagagcggtc gcggatcgtg cttcacgaat tcgccgcgca      1620
     ccgcgagcca ggcgtgcagc gcgtcgagcg ccttgcggcc gacgggcacc ttgcgctcct      1680
     tgtcgccctt gccgcgcacg gtga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page