(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE388

CP000124.PE388       Location/Qualifiers
FT   CDS_pept        412654..413574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0397"
FT                   /product="Phytanoyl-CoA dioxygenase (PhyH) family"
FT                   /note="identified by match to protein family HMM PF05721"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49141"
FT                   /db_xref="GOA:Q3JX92"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX92"
FT                   /protein_id="ABA49141.1"
FT                   /translation="MAGARPTVPLRYIKFAATIARRFSLRGMVASMSRTSVLQSFIDNN
FT                   DADHPMSSLHPELIHTQVQTLRERGFVVAPGLVAPERCAQLKTIAERQLREAAQPLEFE
FT                   ADLRYPGAPESRHAPGGHTVRRLLDAYARDAAFAERATAPEIGAWMRAYFDETPVLSRA
FT                   HHNCVMTKHPAYGSLTGWHRDVRYWSFERPDLVSVWLALGPETDDNGALWLVPGSHDAE
FT                   FGPERFDEAKFFRGDVPANRRLIEQAVCPALAAGDVVFFHCNTLHSAGQNRSDQVKFSL
FT                   VFTYHGDSNRPVPGSRSASKPEVRF"
     gtggcgggtg cgcgcccgac agttcctttg cgttacatca aattcgcggc gacgatcgcg        60
     cgccgttttt cacttcgcgg catggtggcg agcatgtcgc gcacgtccgt tttacaatcg       120
     ttcatcgata acaatgacgc cgaccacccc atgtcttcct tgcacccgga gttgattcac       180
     acgcaggtcc agacgctgcg cgagcgcggc ttcgtcgtcg caccggggct cgtcgcaccc       240
     gagcggtgcg cgcaactgaa gacgatcgcc gagcggcagt tgcgcgaggc ggcgcagccg       300
     ctcgaattcg aggccgacct gcgctatccg ggcgcgcccg aatcgcggca cgcgccgggc       360
     ggccatacgg tgcggcggct gctcgatgca tacgcgcgcg atgcggcgtt cgccgagcgc       420
     gcgaccgcgc ccgagatcgg cgcgtggatg cgtgcgtact ttgacgaaac gccggtgctc       480
     tcgcgcgcgc atcacaactg cgtgatgacg aagcatccgg catacggcag cctgaccggc       540
     tggcatcgcg acgtgcgcta ttggtcgttc gagcgcccgg atctcgtatc cgtgtggctc       600
     gcgctcgggc cggagacgga cgacaacggc gcgctatggc tcgtgccggg ctcgcatgac       660
     gcggaattcg ggccggagcg tttcgacgaa gcgaagttct ttcgcggcga cgtgccggca       720
     aaccgtcggt tgatcgagca ggcggtgtgc ccggcgctcg cggcgggcga tgtcgtgttc       780
     ttccactgca atacgctgca ttcggcgggg cagaaccgca gcgatcaggt gaagttctcg       840
     ctcgtgttca cctatcacgg cgacagcaat cggccggtgc ccggctcgcg ctcggcgtcg       900
     aaaccggagg tgcggttcta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page